DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and TwdlY

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_728017.1 Gene:TwdlY / 318093 FlyBaseID:FBgn0052570 Length:247 Species:Drosophila melanogaster


Alignment Length:250 Identity:82/250 - (32%)
Similarity:113/250 - (45%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSIVAAASAGSLSGYNY---------------GQGATTSIGGSGVSPVPALAG-----PVSYSAA 51
            |.:||...|....||..               |.|...|.||..||..|...|     |.|.:.|
  Fly    11 LILVALTQARPQYGYEQPSSDIFIGGGSAPVGGVGIGGSSGGGLVSIQPHRGGDKYLPPASTTLA 75

  Fly    52 PQASVHKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAVLALAKQAAQQQ- 115
            |  .::|:||...|.:|...|.......|...:||.||:|||:|..   :||.:..:.:.|.|: 
  Fly    76 P--IINKKFYLVSAPEDHSNDGKVKHLVLGRPQKNYRVVFIKAPAG---DNANVKYSAEFAPQEE 135

  Fly   116 -TAIYVLHKQ---TDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSS 176
             |.||||.|:   .|.:::|..  |..|.:  ||||.|:||:|.::|..||:.||.|||:|||::
  Fly   136 KTVIYVLSKKDNDVDASDIATP--APTQPS--KPEVFFIKYKTDDEAKQAQQEIQGQYDKLGGTN 196

  Fly   177 --QSINGGVANAINFASQGAAP---------ARVTPQQVPQSNYLPANILSRLRH 220
              |..|.....::..:..|..|         |...|..||.|.|||    |.|:|
  Fly   197 EYQEDNNAPITSVIGSLDGLNPDGSYNYRQIANRPPAVVPNSQYLP----SLLKH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 34/99 (34%)
TwdlYNP_728017.1 DM5 76..175 CDD:214776 37/107 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.