DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and TwdlZ

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster


Alignment Length:186 Identity:63/186 - (33%)
Similarity:93/186 - (50%) Gaps:22/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GSGVSPVPALAGPVSYSAAPQASVHKEFYSFYANDD--DFEDKAALQRALASVKKNIRVIFIKSP 95
            ||...|.|        :.|.:..:.|:|||....:|  |.|.:.. ...:...::|.|||||::|
  Fly    20 GSRYLPPP--------NPAMEPIITKQFYSISPAEDPEDLEPRTK-HLVIGQPRRNYRVIFIRAP 75

  Fly    96 E-NRGYENAVLALAKQAAQQQTAIYVL-HKQTDINELAQKFNAVRQNA--NKKPEVHFVKYRTPE 156
            . |..:......||.|  :::|.|||| .||.::.  |....|.:|.:  .:||:|.|:||:|.:
  Fly    76 TGNSEHVKYTAELAPQ--EERTVIYVLTRKQQELE--AADIMAPQQKSQVEQKPDVFFIKYKTND 136

  Fly   157 DAANAQRAIQSQYDQLGGSSQSINGGVA---NAINFASQGAAPARVTPQQVPQSNY 209
            :||.|||.||:|||||||:::.....||   :.|...|....||...|.|.....|
  Fly   137 EAAAAQREIQTQYDQLGGNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQSPGY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 32/100 (32%)
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.