DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and CG34305

DIOPT Version :10

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001097671.1 Gene:CG34305 / 5740825 FlyBaseID:FBgn0085334 Length:79 Species:Drosophila melanogaster


Alignment Length:58 Identity:22/58 - (37%)
Similarity:36/58 - (62%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVAPVLNFAS 263
            |:|..:..:|.|.|..::|:...|.||.||||..||:::||:::.|....|.::|.||
  Fly    17 LSAPAAATDNAPTVSVLRYKDDRDLANIQRAIIAQYERIGGTTKVHQPLTANIVNPAS 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DUF243 130..224 CDD:460806 5/17 (29%)
CG34305NP_001097671.1 None

Return to query results.
Submit another query.