DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlT

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:283 Identity:98/283 - (34%)
Similarity:124/283 - (43%) Gaps:62/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVM-CLVAVACADKLGYNYQ-------PVGHSSSGLSFAPGSGSIG--GGSIG---GGSIG 52
            |:|||:| ||...|...:.||||.       ..|.|..||....|.||.|  ||.||   ||..|
  Fly     1 MKAFILMSCLALAAARPEAGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFG 65

  Fly    53 GGSIGGG---------SIGGGSIGGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSIGSIGSIG 108
            |||.|||         |.|||..|||..||..||||.|   |||.|.|     ||||||..|..|
  Fly    66 GGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGG---GSGGGFG-----GGGSIGGFGGGG 122

  Fly   109 GGDALSAPVSYNAPAPTAELEKEFFTFTANEQDFDEPQQLERVSSALN-------KALRVVFIKG 166
            ||.           ..|..::|..:...       .|.:.|.|....|       |..:::|||.
  Fly   123 GGG-----------GGTTLVQKHIYVHV-------PPPEQEEVRQRPNLPIGQSQKHYKIIFIKA 169

  Fly   167 PENRGLENAALALAKQAAQQETAIYVL-NKQADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDA 230
            |.....:...:.|..| .:::|.:||| .|..|..|:.....|  ....:||||:|:||:|.:|:
  Fly   170 PSPPSYQAPVIPLQPQ-NEEKTLVYVLVKKPEDQQDIVIPTPA--PTQPSKPEVYFIKYKTQKDS 231

  Fly   231 ANAQRAIQGQYDQLGGSSQAHNG 253
            :.....|.|   ..||.:|.:.|
  Fly   232 SGISGGISG---STGGFTQTNTG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 27/108 (25%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.