DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlC

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:177 Identity:45/177 - (25%)
Similarity:75/177 - (42%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YNAPAPTAELEKEFFTFTANEQDFDEPQQLE-RV---SSALNKALRVVFIKGPENRGLENAALAL 179
            ||......::.|..:.... .:||:|...:: ||   .....|..::||||.|....:....:..
  Fly   118 YNNGPQETKVHKHIYVHVP-PKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPP 181

  Fly   180 AKQAAQQETAIYVLNK----QADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQ 240
            ..| .:::|.||||:|    :.||     .:........:||||:|:||:|.:|.|........:
  Fly   182 PPQ-NEEKTLIYVLHKKPEQEQDI-----VIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAE 240

  Fly   241 YD--QLGGSSQAHNGGVAPVLNFASAAPVRQAAAQSPDNSYLPSSVF 285
            .:  |......|....||.||...:.||..:...:.|   .:||:|:
  Fly   241 MEPRQATAEDFAPLAEVADVLPPTTLAPAPEPEVEQP---AIPSAVY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 28/108 (26%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.