DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlD

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:298 Identity:136/298 - (45%)
Similarity:177/298 - (59%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVAC-ADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGG 64
            ||||||:||:||:| |||||||||||.|:..||||.||||.:                       
  Fly     1 MRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLSFLPGSGQV----------------------- 42

  Fly    65 SIGGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSIGSIGSIGGGDA-LSAPVSYNAPAPTA-- 126
                                     :|.|.|       .:..:..|:| ||.|:.    ||.|  
  Fly    43 -------------------------IGELPS-------QVLPVQSGEAVLSQPIE----APVAPQ 71

  Fly   127 ------ELEKEFFTFTANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQAAQ 185
                  |.:|||:::.|.|:.:||....::::::|.|.||||||:.|||:|.|.|||.||||:||
  Fly    72 IAPLVEEFQKEFYSYAAPEEQYDEGASNQQIANSLKKNLRVVFIRTPENQGFERAALQLAKQSAQ 136

  Fly   186 QETAIYVLNKQADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQA 250
            ||||||||.||:|:.:||.:|||:::::.||||||||||||||||||||.|||.||:||.|.|:.
  Fly   137 QETAIYVLTKQSDVSNLAKQLNALKTSSTNKPEVHFVKYRTPEDAANAQLAIQNQYNQLPGVSRI 201

  Fly   251 HNGGVAPVLNFAS----AAPVRQAAAQSPDNSYLPSSV 284
            .|.|.||||||||    ||.:...||.:|.:.|||::|
  Fly   202 SNEGRAPVLNFASSPAQAAAIPAVAAAAPSSEYLPANV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 58/108 (54%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 57/99 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.