DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlN

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:311 Identity:230/311 - (73%)
Similarity:252/311 - (81%) Gaps:29/311 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSI----GGGSIG-GGSIGGGSIGGGS 60
            ||||:|:||||:|.||||||||:|||||||||||||||||:    ||||:| |||.|...:||.|
  Fly     1 MRAFVVLCLVAIASADKLGYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLGGAS 65

  Fly    61 ----IGGGS-----------IGGGSIG-GSIGGGSIGASIGSGAGLGGL-SSIGGGSIGS-IGSI 107
                :||||           :|||||. ||.|.||.|  :|||.|..|| |.:|...:|| :||.
  Fly    66 GSLGLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSG--LGSGLGSSGLGSGLGSSGLGSGLGSA 128

  Fly   108 GGGDALSAPVSYNAPAPTAELEKEFFTFTANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGL 172
            |    ||||||||||||.|||:|||||:||||:||||||.||||:|::||.||||||||||||||
  Fly   129 G----LSAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERVASSVNKGLRVVFIKGPENRGL 189

  Fly   173 ENAALALAKQAAQQETAIYVLNKQADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAI 237
            |||||||||||||||||||||||||||||||.||||||||:||||||||||||||||||||||||
  Fly   190 ENAALALAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPEDAANAQRAI 254

  Fly   238 QGQYDQLGGSSQAHNGGVAPVLNFASAAPVRQAAAQSPDNSYLPSSVFRRV 288
            |.|||||||||||.|||||..||||||.|||||.||.|:||||||||.||:
  Fly   255 QSQYDQLGGSSQAINGGVANALNFASAGPVRQATAQIPENSYLPSSVLRRL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 90/100 (90%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 90/100 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443771
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.