DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlK

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster


Alignment Length:289 Identity:168/289 - (58%)
Similarity:195/289 - (67%) Gaps:47/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAP-GSGSIGGGSIGGGSIGGGSIGGGSIGGG 64
            ||:|:|:|.:|:|.|||||||||||.||.|||||.| ||.|....:.                  
  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAF------------------ 47

  Fly    65 SIGGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSIGSIGSIGGGDALSAPVSYNAPAPTAELE 129
                             |...|.:...|.|||.       .::.|..:.:||   |..||.|:||
  Fly    48 -----------------APAPSASFAPGPSSIA-------DALEGSQSAAAP---NYAAPQAQLE 85

  Fly   130 KEFFTFTANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQAAQQETAIYVLN 194
            |||||:||:|.||.:|...:||::|:||.|||||||||||.|||:||||||||||||||||||||
  Fly    86 KEFFTYTADEGDFYDPSASDRVANAVNKGLRVVFIKGPENSGLEDAALALAKQAAQQETAIYVLN 150

  Fly   195 KQADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVAPVL 259
            |||||||||||||:||:|||||||||||||||||||||||.||||||||||||||:.|||||..|
  Fly   151 KQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQSQNGGVASTL 215

  Fly   260 NFAS-AAPVRQAAAQSPDNSYLPSSVFRR 287
            |||| .||....||.:|..||||:::|||
  Fly   216 NFASQPAPRESTAASAPGPSYLPANIFRR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 82/100 (82%)
TwdlKNP_651488.1 DM5 82..183 CDD:214776 82/100 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443786
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.