DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlO

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster


Alignment Length:296 Identity:139/296 - (46%)
Similarity:166/296 - (56%) Gaps:78/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGS 65
            ||..|..||:..|||.   |||                             |.|..|..|....|
  Fly     1 MRFLIAFCLIGAACAQ---YNY-----------------------------GAGFTGAASDNVPS 33

  Fly    66 IGGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSIGSIGSIGGGDALSAPVSYNAPAPTAELEK 130
            ..|.|:|.|..|                                  |.|:| .|:.   ::||.|
  Fly    34 YSGSSVGDSYDG----------------------------------AASSP-DYSV---SSELNK 60

  Fly   131 EFFTFTANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNK 195
            |::||.|:|..|::|...::::.::||.||||||||||||||||||||||||||:|.||||||||
  Fly    61 EYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNK 125

  Fly   196 QADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVAPVLN 260
            |.||||||.|.||.|.|:|.:||||||||||||||||||||||.|||.||||||:.|||||..:|
  Fly   126 QTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAIN 190

  Fly   261 FASAAPV---RQAAAQSP-----DNSYLPSSVFRRV 288
            |||||||   |:....||     .|||||:::.||:
  Fly   191 FASAAPVVPARRGPNYSPPAAATSNSYLPANILRRL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 69/100 (69%)
TwdlONP_651487.1 DM5 56..157 CDD:214776 69/100 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443794
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.