DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlL

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster


Alignment Length:291 Identity:246/291 - (84%)
Similarity:265/291 - (91%) Gaps:12/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGS 65
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.
  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGL 65

  Fly    66 IGGGSI-GGSIGGGSIGASIGSG---AGLGGLSSIGGGSIGSIGSIGGGDALSAPVSYNAPAPTA 126
            |||||| ||||||||:|.|||.|   :|||||        |.:|.:||||||:||||||||||.|
  Fly    66 IGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGL--------GGLGGLGGGDALAAPVSYNAPAPAA 122

  Fly   127 ELEKEFFTFTANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQAAQQETAIY 191
            ||:|||||::||||||||||:||||:.::||.|||||||||||||||||||||||||||||||||
  Fly   123 ELQKEFFTYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIY 187

  Fly   192 VLNKQADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVA 256
            ||||||||||||.||||||:|||||||||||||||||||||||||||.|||||||||||||||||
  Fly   188 VLNKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVA 252

  Fly   257 PVLNFASAAPVRQAAAQSPDNSYLPSSVFRR 287
            |.||||||.||::|.||.|:|:|||:|:|||
  Fly   253 PALNFASAGPVQKANAQIPENAYLPTSIFRR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 89/100 (89%)
TwdlLNP_733158.1 DM5 122..223 CDD:214776 89/100 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.