DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlP

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:291 Identity:133/291 - (45%)
Similarity:165/291 - (56%) Gaps:76/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKL-GYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGG 64
            |||.|::.:||.|.|..| ||||                                          
  Fly     1 MRALIILSIVAAASAGSLSGYNY------------------------------------------ 23

  Fly    65 SIGGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSIGSIGSIGGGDALSAPVSYNAPAPTAELE 129
                                    |.|..:||||..:..:      .||:.||||:| ||.|.:.
  Fly    24 ------------------------GQGATTSIGGSGVSPV------PALAGPVSYSA-APQASVH 57

  Fly   130 KEFFTFTANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQAAQQETAIYVLN 194
            |||::|.||:.||::...|:|..:::.|.:||:|||.|||||.|||.||||||||||:||||||:
  Fly    58 KEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAVLALAKQAAQQQTAIYVLH 122

  Fly   195 KQADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVAPVL 259
            ||.||.:||.|.||:|.|.|.|||||||||||||||||||||||.||||||||||:.|||||..:
  Fly   123 KQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVANAI 187

  Fly   260 NFAS--AAPVRQAAAQSPDNSYLPSSVFRRV 288
            ||||  |||.|....|.|.::|||:::..|:
  Fly   188 NFASQGAAPARVTPQQVPQSNYLPANILSRL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 63/100 (63%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 59/94 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.