DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlV

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_649446.1 Gene:TwdlV / 40537 FlyBaseID:FBgn0037227 Length:251 Species:Drosophila melanogaster


Alignment Length:287 Identity:86/287 - (29%)
Similarity:120/287 - (41%) Gaps:100/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGS 65
            |..|||:||.:||.|...||||.|                                         
  Fly     1 MSGFIVLCLCSVALAAPQGYNYNP----------------------------------------- 24

  Fly    66 IGGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSIGSIGSIGGGDALSAPVS----YNAPA--- 123
                           |.|     |.||:|:..||     ||...|....|||.    |..||   
  Fly    25 ---------------GPS-----GFGGISTTTGG-----GSFFQGAVQVAPVQPQAVYQQPAAQT 64

  Fly   124 ----------PTAELEKEFFTFTANE--QDFDEPQQLERVSSALNKA-LRVVFIKGPENRGLENA 175
                      ..|.:.|.||..:|.|  :|:.|    ..::..:.|. ..|||||.|:..  ...
  Fly    65 HHHQQQQVQQQQAIVSKRFFIHSAPEEAEDYKE----RHITVGVPKRNYNVVFIKSPQRN--NRK 123

  Fly   176 ALALAKQAAQQETAIYVLNKQADIGDLANKLNA---IRSNNNNKPEVHFVKYRTPEDAANAQRAI 237
            .:.::..|.:::|.||||:|:.:     :.|||   .::::.:||||.|:||:|.|:||:||:.|
  Fly   124 TIKISPAANEEKTVIYVLSKKGE-----SDLNAEVVEQASSTSKPEVFFIKYKTNEEAAHAQQQI 183

  Fly   238 QGQYDQLGGSSQAHNGGVAPVLNFASA 264
            |.|||.||||||..:.|||||.:...|
  Fly   184 QAQYDALGGSSQLTDEGVAPVTSVIGA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 32/106 (30%)
TwdlVNP_649446.1 DM5 78..173 CDD:214776 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.