DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlG

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster


Alignment Length:306 Identity:88/306 - (28%)
Similarity:133/306 - (43%) Gaps:52/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGG-GSIGGGSIGGGSIGGG 64
            |..|||.||:.:|.....|||||    :...|..:..:|.:...||.. .::...:|        
  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQ----AQQQLQSSAQAGQLHLPSIPQFATLAEQTI-------- 53

  Fly    65 SIGGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSI--GSIGSIGGGDALSAPVSYNAPAPTAE 127
                  :..::....:...:..|.||...|:....|.  ......|...|.:|....:.|.....
  Fly    54 ------LQQALQAPKLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALPQAHQPQQQHL 112

  Fly   128 LEKEFFTFT--ANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQAAQQETAI 190
            :.|:.:...  |.|.:...||.: ...:...|..|:||||.| ...:..|||.:.:...:::|.|
  Fly   113 VSKDIYVHVPPAEEPEDRYPQPV-LPPAPPRKHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTII 175

  Fly   191 YVLNKQADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGV 255
            |||.|:.|..||...:..|.....:||||.|:||:|.|:||:|||.||.|||||||:||..:.||
  Fly   176 YVLTKKPDPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGV 240

  Fly   256 APVLN-----------------FASAAPVRQAAAQSPDNSYLPSSV 284
            |||.:                 |:.:.|          |||||:::
  Fly   241 APVTSVIGVLDNQRNNGISSGQFSGSLP----------NSYLPTNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 32/102 (31%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.