DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlE

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:192 Identity:46/192 - (23%)
Similarity:73/192 - (38%) Gaps:48/192 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DALSAPVS-----------YNAPAP-------TAELEKEFFTFT-ANEQDFDEPQQLERVSSALN 156
            |:.|||.|           |.||||       ...:.|..:... ..|.::..|::...|... .
  Fly    26 DSYSAPPSSSYQPSGPSGGYGAPAPQYGPPQQAPVIHKHVYVHVPPPEPEYQAPRKPLYVPPP-Q 89

  Fly   157 KALRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNK----QADIGDLANKLNAIRSNNNNKP 217
            |..::||||.| :..:..|.:.......:::|.:|||.|    |.:|     .:........:||
  Fly    90 KHYKIVFIKAP-SPPVPTAPVIPQFPQNEEKTLVYVLVKKPEEQPEI-----IIPTPAPTQPSKP 148

  Fly   218 EVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVAPVLNFASAAPVRQAAAQSPDNSY 279
            ||:|::|:|       |:...|.|.         |....|...:  .||....|..:|.:||
  Fly   149 EVYFIRYKT-------QKEETGPYP---------NSVAPPAPEY--GAPAAPPAPSAPSSSY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 24/105 (23%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.