DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and Twdlalpha

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:344 Identity:110/344 - (31%)
Similarity:154/344 - (44%) Gaps:84/344 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMC-LVAVACADKLGYNY-----------QPVGHSSSGLSFAPGSGSIGG-GSIGG---- 48
            ||.|:.:| |:.::.|...||||           ...|.||.|...||...|:.. |.:|.    
  Fly     1 MRLFVTLCSLLVLSQAKPQGYNYGSGVSGSLTTSGSSGGSSGGFLTAPSHSSVASYGPLGAFQTA 65

  Fly    49 --GSIGGGSIGGGSI---GGG-----SIGGG-------SIGG-----SIGGGSIGASIGSGAGLG 91
              ||:.|.|....|:   |||     :.|||       |.||     |.||.....|.|..:..|
  Fly    66 SVGSLVGSSSAPHSVSHYGGGNGATYTTGGGNGHAATYSTGGHGATYSTGGNGATYSTGGSSNYG 130

  Fly    92 GLSSIGGGSIGSIGSIGGGDALSAPVSYNAPAPTAELE-------------KEFFTFTANEQDFD 143
            |.|..|.|...:||       ..|...|.||....:.|             |:|||..|.|    
  Fly   131 GSSFTGFGPTPNIG-------FGALAGYQAPTYQQQQEQEVQRGFQEPIIHKQFFTVAAPE---- 184

  Fly   144 EPQQLER----VSSALNKALRVVFIKGPENRGLENAALALAKQAA--QQETAIYVLNK---QADI 199
            |.:.|||    |.....|..||||||.|.:   .||.:.|:.:.|  :::|.||||:|   |.::
  Fly   185 EHENLERSKHLVIGRPQKNYRVVFIKAPSS---SNANVKLSAEYAPKEEKTVIYVLSKKDNQLEV 246

  Fly   200 GDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVAP---VLNF 261
            .|:|.....:.|    ||||.|:||:|..:|::||:.||.:||::.|:|:..:|||||   |:..
  Fly   247 NDIATPAPTVPS----KPEVFFIKYKTDAEASHAQQQIQAEYDRIEGTSEHQDGGVAPAQSVVGI 307

  Fly   262 ASAAPVRQAAAQSPDNSYL 280
            .....:  .||.|..::|:
  Fly   308 LDGGAI--GAASSGSSNYV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 41/122 (34%)
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776 40/109 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.