DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlY

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_728017.1 Gene:TwdlY / 318093 FlyBaseID:FBgn0052570 Length:247 Species:Drosophila melanogaster


Alignment Length:299 Identity:94/299 - (31%)
Similarity:128/299 - (42%) Gaps:83/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVMCLVAVACAD---KLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGSI 66
            :|.||:.||...   :.||. ||    ||.:                      .|||||   ..:
  Fly     7 LVSCLILVALTQARPQYGYE-QP----SSDI----------------------FIGGGS---APV 41

  Fly    67 GGGSIGGSIGGGSIGASIGSGAGLGGLSSIGGGSIGSIGSIGGGDALSAPVSYNAPAPTAELEKE 131
            ||..||||.|||.:                      ||....|||....|.| ...||.  :.|:
  Fly    42 GGVGIGGSSGGGLV----------------------SIQPHRGGDKYLPPAS-TTLAPI--INKK 81

  Fly   132 FFTFTANEQDFDEPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQAAQQE--TAIYVLN 194
            |:..:|.|...::.:....|.....|..||||||.|..   :||.:..:.:.|.||  |.||||:
  Fly    82 FYLVSAPEDHSNDGKVKHLVLGRPQKNYRVVFIKAPAG---DNANVKYSAEFAPQEEKTVIYVLS 143

  Fly   195 KQ---ADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVA 256
            |:   .|..|:|..    .....:||||.|:||:|.::|..||:.||||||:|||:::......|
  Fly   144 KKDNDVDASDIATP----APTQPSKPEVFFIKYKTDDEAKQAQQEIQGQYDKLGGTNEYQEDNNA 204

  Fly   257 PV---------LNFASAAPVRQAA----AQSPDNSYLPS 282
            |:         ||...:...||.|    |..|::.||||
  Fly   205 PITSVIGSLDGLNPDGSYNYRQIANRPPAVVPNSQYLPS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 34/105 (32%)
TwdlYNP_728017.1 DM5 76..175 CDD:214776 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.