DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlM and TwdlZ

DIOPT Version :9

Sequence 1:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster


Alignment Length:175 Identity:62/175 - (35%)
Similarity:87/175 - (49%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PAPTAE--LEKEFFTFTANEQDFD-EPQQLERVSSALNKALRVVFIKGPENRGLENAALALAKQA 183
            |.|..|  :.|:|::.:..|...| ||:....|.....:..||:||:.|  .|........|:.|
  Fly    27 PNPAMEPIITKQFYSISPAEDPEDLEPRTKHLVIGQPRRNYRVIFIRAP--TGNSEHVKYTAELA 89

  Fly   184 AQQE-TAIYVLNKQ------ADIGDLANKLNAIRSNNNNKPEVHFVKYRTPEDAANAQRAIQGQY 241
            .|:| |.||||.::      |||.....|     |....||:|.|:||:|.::||.|||.||.||
  Fly    90 PQEERTVIYVLTRKQQELEAADIMAPQQK-----SQVEQKPDVFFIKYKTNDEAAAAQREIQTQY 149

  Fly   242 DQLGGSSQAHNGGVAPVLNF--ASAAPVRQAA-----AQSPDNSY 279
            |||||:::.....|||:.:.  |.::|...||     .|||...|
  Fly   150 DQLGGNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQSPGYHY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlMNP_651484.1 DM5 126..227 CDD:214776 34/110 (31%)
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.