DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plum and Cdon

DIOPT Version :9

Sequence 1:NP_001163744.1 Gene:plum / 43197 FlyBaseID:FBgn0039431 Length:1298 Species:Drosophila melanogaster
Sequence 2:NP_059054.2 Gene:Cdon / 50938 RGDID:708433 Length:1256 Species:Rattus norvegicus


Alignment Length:1285 Identity:263/1285 - (20%)
Similarity:407/1285 - (31%) Gaps:410/1285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 STALQPYLQIQKHAVTRLTISKPHS-------PYYLPCIPILTPYNHDQDNQPIYC--SWYRN-- 101
            |:.|.||.           ||:|.|       |..|.|           ..:|:..  ||..|  
  Rat    23 SSDLAPYF-----------ISEPLSAVQKLGRPVVLHC-----------SAKPVTARISWLHNGK 65

  Fly   102 --DVVVEQVSYRKNDFFIYDNGTLR-LPTNEKASGEYYCKIEWDESAVISDRITVEYPVLKRLFP 163
              |...||:...:        |||. |..|...||.|.|.......||:|...||....|.....
  Rat    66 RLDRNTEQIKIHR--------GTLTILSLNPSLSGCYQCVANNSVGAVVSGPATVSAAALADFDS 122

  Fly   164 GQQQAANISALENKPLVLSCPFLSVPAA----------RFSWYFGNDSLTNDNSALILTNGTLIL 218
            .....  |:|.|.....:.|   .||.:          |..|.     :.:..:.:||.:|.|.:
  Rat   123 STMHV--ITAEEKNTGFIGC---RVPESNPKAEVRYKIRGKWL-----MYSTGNYIILPSGNLQI 177

  Fly   219 RHLRLEQAGKYKCVAQNTFASKTHRQFIWQLQVEPKDATFYPKNEAGITETAVSEAQ------LL 277
            .::..:..|.|||.|.|...|        :|:|||          || .:..||...      |.
  Rat   178 LNVSSKDKGSYKCAAYNPVTS--------ELKVEP----------AG-RKLLVSRPSSDGFHILH 223

  Fly   278 PAFQNATVFVPAGGSVLLQCHAVADFVPI--VWYLQPPNNKMVRLSNNSVAYS-ITNASI-ARHE 338
            ||...|...:| ...|.|:|  |...||.  |::|:...:.:.. ||....|| :..||| ....
  Rat   224 PALSQALAVLP-HSPVTLEC--VVSGVPASQVYWLKDGQDALSG-SNWRRLYSHLATASIDPADS 284

  Fly   339 GRYSCIT------PLETQNFQVIVTTPPRIVSRLPVEVVYIGLSRTLTCRAEGHPEPSITWYHNG 397
            |.|||:.      .::...:.|.|.....|...|..:.|.:|.:...||...|:|.|:.||:||.
  Rat   285 GNYSCVVGNNRSGDVKHVTYTVNVLEHASISKGLHDQKVSLGATVRFTCEVHGNPAPNRTWFHNA 349

  Fly   398 VHLNSSYTRYISGNELHVHSFDSKEEGIYQCVARNVAGEDSATGELRFNRQLEE--------VNP 454
            ..:..|......|:.|.:.....::.|:|||:|.|..|...:||.|    |:|:        |..
  Rat   350 QPIRPSSRHLTEGSVLKITGVIMEDSGLYQCMADNGIGFMQSTGRL----QIEQDSGQRPVIVTA 410

  Fly   455 LQNIRCYPHSF--HSINIT---------FDSRTLTSMFVVYIVRNNPHSWTSFSPMKLN-QTSYV 507
            ..|:......|  .|.|.|         :....|.:.....::|:.......|.|..|: :..|:
  Rat   411 PANVEVTDGDFVTLSCNATGEPVPVIHWYGRHGLITSHPSQVLRSKSRKSHLFRPGDLDPEPVYL 475

  Fly   508 VI----STDLPVY---------------------EPFALITRVLFPTTEVRTGTLVPQQMILSSL 547
            ::    |:.|.:.                     :..|.:|.|.| .|..:...:.|.:...:..
  Rat   476 IMSQAGSSSLSIQAVTWEHAGKYTCEAVNKHGSTQSEAFLTVVPF-ETNTKAEPVTPSEASQNDE 539

  Fly   548 RSTPVTCCTQGLM-LRPIAVGN----------------------------DTF-VKWSQGQ---L 579
            |. |......||: |.|:.|.:                            ||: :.|..|:   :
  Rat   540 RD-PRDGSESGLLNLFPVKVHSGGVELPAEKNASVPDAPNILSPPQTHMPDTYTLVWRAGRDGGM 603

  Fly   580 ENKKYFILQFSINHTHPHPAQLLNGS-LQGTLTSVEEKADQVRHHLTEIQPLNQSAAATVLRNVE 643
            ....||:..          .:|.:|| ..|:..:|.....:...||||::|.:......|.|:  
  Rat   604 PINAYFVKY----------RKLDDGSGAVGSWHTVRVPGSESELHLTELEPSSLYEVLMVARS-- 656

  Fly   644 HEDNVVDDTLELEDDIFSLVVDASVTGILLQRFTRIKMRVLIITTENEF--LGQDFRYVQWKIIE 706
                               .|......:|..|.::.|| .....|:..|  :|...|.|      
  Rat   657 -------------------AVGEGQPAMLTFRTSKEKM-ASSKNTQASFPPVGIPKRPV------ 695

  Fly   707 NGTSEQSNMPFRLVTRES-------RALAFKFLDSLNETCVLECHTEI-QAQMSLPSQDPKCQDR 763
              |||.||..|.:|..:|       .|.....:...:||.|..  |.| :|....|....|.:.:
  Rat   696 --TSEASNSNFGVVLTDSSRHSGVPEAPDRPTISMASETSVYV--TWIPRANGGSPITAFKVEYK 756

  Fly   764 NIANSLLLVT--------------GLKPDTRYNLHFYNCKTRIF----YGDIDEKTEQDP----- 805
            .:.:|..||.              .|:|.:.|       |.|:.    ||:....:...|     
  Rat   757 RMKSSDWLVAAEDIPPSKLSVEVRSLEPGSIY-------KFRVIAINHYGESFRSSASRPYQVAG 814

  Fly   806 -PGTISN----------SKLIKQNGLKLMWE--PPINPNGRVH---------------------- 835
             |...||          ::.:....:.|.|.  |..|.|..:.                      
  Rat   815 FPNRFSNRPITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVV 879

  Fly   836 ----------------HYDIRWSLDNVTHEAIVKECTKCSYK---FPNVSE--TAKIHVAVRVMG 879
                            .|||:....|...|:.......|..|   .|..||  ..::.......|
  Rat   880 EGSKQWHTIGHLQPETSYDIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPMKELSTPPSSSG 944

  Fly   880 DTGAGAPMYFDMINNNHTWLKEESESSHSEVYSGIAIGSLLSIACVFLFGLFIIFQQRNFKARAQ 944
            :.|...|......:::..:|           ..|..:|.::.|..||:.......:|::...:..
  Rat   945 NGGNVGPATSPARSSDMLYL-----------IVGCVLGVMVLILLVFIALCLWKSRQQSAIQKYD 998

  Fly   945 GPTHLTTPTDIN-----FGNLSSASGMPGDSAGG-LSGGTLQQDCHEMQTLIPRS---------- 993
            .|.:|...::||     :..||..:.:.|...|| ||.|:|...|..:....|..          
  Rat   999 PPGYLYQGSEINGQMVEYTTLSGTARINGSVHGGFLSKGSLSNGCSHLHHKGPNGVNGILNGTIN 1063

  Fly   994 ----RYHIELLPEHSLEYQTSTAAVAVVHLANGNGSVQVA---------------RRSD------ 1033
                ..|...|....:|::...      ||.|| |:|..|               |.::      
  Rat  1064 GGLYSAHTSSLTRTCVEFEHPH------HLVNG-GAVYTAVPQMDPLECINCRNCRNNNRCFTKT 1121

  Fly  1034 --------------QDGAAQGDLGIAGVHNLSQLPLCGV-----GGTSPE 1064
                          |||.....||:      .:.|:|.|     ||..||
  Rat  1122 NSPLPVVPVVASYPQDGLEMKPLGV------MKFPVCPVSTVPDGGQIPE 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plumNP_001163744.1 IG_like 170..241 CDD:214653 19/80 (24%)
IGc2 175..235 CDD:197706 15/69 (22%)
IG_like 284..356 CDD:214653 21/81 (26%)
I-set 360..443 CDD:254352 25/82 (30%)
IGc2 378..435 CDD:197706 18/56 (32%)
FN3 804..886 CDD:238020 21/142 (15%)
CdonNP_059054.2 Ig 28..113 CDD:416386 29/114 (25%)
Ig strand A 28..31 CDD:409353 2/13 (15%)
Ig strand B 45..52 CDD:409353 2/17 (12%)
Ig strand C 57..62 CDD:409353 2/4 (50%)
Ig strand C' 65..67 CDD:409353 0/1 (0%)
Ig strand D 73..77 CDD:409353 1/3 (33%)
Ig strand E 79..83 CDD:409353 3/3 (100%)
Ig strand F 92..100 CDD:409353 3/7 (43%)
Ig strand G 103..113 CDD:409353 4/9 (44%)
Ig 120..196 CDD:416386 18/85 (21%)
Ig strand A 120..123 CDD:409353 0/2 (0%)
Ig strand B 133..144 CDD:409353 2/13 (15%)
Ig strand C 149..155 CDD:409353 0/5 (0%)
Ig strand C' 157..160 CDD:409353 0/2 (0%)
Ig strand D 167..171 CDD:409353 1/3 (33%)
Ig strand E 173..179 CDD:409353 2/5 (40%)
Ig strand F 185..194 CDD:409353 5/8 (63%)
IGc2 236..294 CDD:197706 19/60 (32%)
Ig strand B 238..242 CDD:409353 2/3 (67%)
Ig strand C 251..255 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
Ig 320..397 CDD:416386 24/80 (30%)
Ig strand A' 320..324 CDD:409353 0/3 (0%)
Ig strand B 327..337 CDD:409353 2/9 (22%)
Ig strand C 342..348 CDD:409353 2/5 (40%)
Ig strand C' 349..352 CDD:409353 0/2 (0%)
Ig strand E 363..369 CDD:409353 1/5 (20%)
Ig strand F 376..384 CDD:409353 5/7 (71%)
Ig strand G 387..397 CDD:409353 4/13 (31%)
I-set 405..517 CDD:400151 15/111 (14%)
Ig strand A' 413..417 CDD:409353 1/3 (33%)
Ig strand B 421..429 CDD:409353 3/7 (43%)
Ig strand C 435..457 CDD:409353 2/21 (10%)
Ig strand C' 460..463 CDD:409353 0/2 (0%)
Ig strand D 471..479 CDD:409353 1/7 (14%)
Ig strand E 482..488 CDD:409353 2/5 (40%)
Ig strand F 496..504 CDD:409353 0/7 (0%)
Ig strand G 507..517 CDD:409353 1/9 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..550 4/28 (14%)
fn3 588..663 CDD:394996 19/105 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..696 7/33 (21%)
FN3 718..808 CDD:238020 19/98 (19%)
FN3 833..920 CDD:238020 11/86 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 929..952 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1174..1212
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1231..1256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.