DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plum and ihog

DIOPT Version :9

Sequence 1:NP_001163744.1 Gene:plum / 43197 FlyBaseID:FBgn0039431 Length:1298 Species:Drosophila melanogaster
Sequence 2:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster


Alignment Length:351 Identity:100/351 - (28%)
Similarity:144/351 - (41%) Gaps:46/351 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LRLPTNEKASGEYYCKIEWDESAVISDRITVEYPVLKRLFPGQQQAA----NISALENKPLVLSC 183
            ||:.......|||.| :.|....|::..|.........|...|:..:    .:||  ...::.||
  Fly   118 LRVLVRPDTLGEYRC-VGWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSA--GNSVLWSC 179

  Fly   184 --PFLSVPAARFSWYFGNDSLTNDNSALILTNGTLILRHLRLEQAGKYKCVAQNTFASKTHRQF- 245
              ...|.|:|.:|:|.....:..:   .|.|||.|.|.::..|.:|.|.|.|.|. ||....|. 
  Fly   180 GQQVQSNPSASWSYYRNGVEIKPE---FIGTNGNLFLSNVSSESSGSYSCQATNP-ASGERIQLP 240

  Fly   246 -IWQLQVEPKDATFYPKNEAGITETAVSEAQLL---PAFQNATVFVPAGGSVLLQCHAVADFVPI 306
             ..||||.|:.     ::|:       ....||   |:.|..|  :..|.|:||.|..|....|.
  Fly   241 GSLQLQVTPEQ-----RSES-------KSPHLLRGQPSSQEIT--IREGSSLLLLCPGVGSPPPT 291

  Fly   307 VWYLQPP-----NNKMVRLSNNSVAYSITNASIARHEGRYSC-----ITPLETQNFQVIVTTPPR 361
            |.:..|.     .||..::..:::..|.|..:.|   |.|.|     :.|......:|.|..||:
  Fly   292 VVWSSPDVVGAVKNKRSKVFGHALEISNTRVNDA---GTYICFQDNGVRPALEHYIKVHVEQPPQ 353

  Fly   362 IVSRLPVEVVYIGLSRTLTCRAEGHPEPSITWYHNGVHLNSSYTRYISGNELHVHSFDSKEEGIY 426
            ||.....::...|....|.|:|.|.|.|.|.|..||..........:|.|.|.:||...:..|..
  Fly   354 IVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLILHSVLKRHAGYV 418

  Fly   427 QCVARNVAGEDSATGELRFN-RQLEE 451
            ||.|||..||.||...|:.| :|::|
  Fly   419 QCFARNRLGEHSAGTLLQVNPKQIQE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plumNP_001163744.1 IG_like 170..241 CDD:214653 23/72 (32%)
IGc2 175..235 CDD:197706 18/61 (30%)
IG_like 284..356 CDD:214653 20/81 (25%)
I-set 360..443 CDD:254352 29/82 (35%)
IGc2 378..435 CDD:197706 21/56 (38%)
FN3 804..886 CDD:238020
ihogNP_609085.1 IG_like 59..145 CDD:214653 8/27 (30%)
ig 265..330 CDD:278476 19/69 (28%)
IG_like 267..348 CDD:214653 21/85 (25%)
Ig 314..>377 CDD:299845 17/65 (26%)
IG_like 364..437 CDD:214653 27/72 (38%)
IGc2 365..427 CDD:197706 22/61 (36%)
FN3 467..565 CDD:238020
fn3 580..655 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.