DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plum and rst

DIOPT Version :9

Sequence 1:NP_001163744.1 Gene:plum / 43197 FlyBaseID:FBgn0039431 Length:1298 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:465 Identity:100/465 - (21%)
Similarity:160/465 - (34%) Gaps:143/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VSYRKNDFFIYDNGTLRLPTNEKASG-EYYCKIEWDESAVISDRITVEYPVLK--------RLFP 163
            :.:.|:||        .|.|:...|| |.|..:..||....|..|   |||:.        ::.|
  Fly    58 LQWTKDDF--------GLGTSRDLSGFERYAMVGSDEEGDYSLDI---YPVMLDDDARYQCQVSP 111

  Fly   164 GQQ------------------------QAANISALENKPLVLSCPFLSV---PAARFSWYFGNDS 201
            |.:                        |...|.|.|::.:.:.|  :||   |||..:|..|..:
  Fly   112 GPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIEC--VSVGGKPAAEITWIDGLGN 174

  Fly   202 LTNDN----------SALILTNGTLILRHLRLEQAGKYKCVAQNTFASKTHRQFIWQLQVEPKDA 256
            :..||          .........|.|...:......:.|.|||| |.:|:|..  :::||.|  
  Fly   175 VLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNT-ADRTYRSA--KIRVEVK-- 234

  Fly   257 TFYPKNEAGITETAVSEAQLLPAFQNATVFVPAGGS--------------VLLQCHAVAD--FVP 305
             :.||.:..:..:       ||.....:|....|||              |.|:|.|.|:  .|.
  Fly   235 -YAPKVKVNVMGS-------LPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVR 291

  Fly   306 IVWYLQPPNNKMVRLSNNSVAYSITNASIARHEGRYSCITPLETQNF--------QVIVTTPPRI 362
            ..|::   |::.: :........|.|.:...|:....|    |.||.        .:.::..|..
  Fly   292 YRWFI---NDEPI-IGGQKTEMVIRNVTRKFHDAIVKC----EVQNSVGKSEDSETLDISYAPSF 348

  Fly   363 VSRLPVEVVYIGLSRTLTCRAEGHPEPSITWYHN------GVHLNSSYTRYISGNELHVHSFDSK 421
            ..|.......:|...:|||..:.:|:|.|.|..:      |...|.::            |..::
  Fly   349 RQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTF------------SVSNE 401

  Fly   422 EEGIYQCVARNVAG-------------EDSATGELRFNRQLEEVNPLQNIRCY----PHSFHSIN 469
            ..|.|.|.| ||.|             ...|.|..|  .|...|.....|.|:    |.:.| ::
  Fly   402 TAGRYYCKA-NVPGYAEISADAYVYLKGSPAIGSQR--TQYGLVGDTARIECFASSVPRARH-VS 462

  Fly   470 ITFDSRTLTS 479
            .||:.:.::|
  Fly   463 WTFNGQEISS 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plumNP_001163744.1 IG_like 170..241 CDD:214653 21/83 (25%)
IGc2 175..235 CDD:197706 15/72 (21%)
IG_like 284..356 CDD:214653 19/95 (20%)
I-set 360..443 CDD:254352 22/101 (22%)
IGc2 378..435 CDD:197706 16/62 (26%)
FN3 804..886 CDD:238020
rstNP_001284835.1 IG_like 34..130 CDD:214653 18/82 (22%)
Ig 42..114 CDD:299845 18/66 (27%)
C2-set_2 135..225 CDD:285423 23/92 (25%)
Ig_3 265..329 CDD:290638 13/71 (18%)
I-set 346..420 CDD:254352 20/86 (23%)
Ig 360..425 CDD:299845 18/77 (23%)
Ig5_KIRREL3-like 428..524 CDD:143235 12/48 (25%)
IG_like 435..524 CDD:214653 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.