DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plum and HMCN2

DIOPT Version :10

Sequence 1:NP_651482.3 Gene:plum / 43197 FlyBaseID:FBgn0039431 Length:1298 Species:Drosophila melanogaster
Sequence 2:NP_001278744.1 Gene:HMCN2 / 256158 HGNCID:21293 Length:5079 Species:Homo sapiens


Alignment Length:1456 Identity:295/1456 - (20%)
Similarity:470/1456 - (32%) Gaps:439/1456 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HNGRLTLTKESTTVAAAVAQPK--NSTALQPYLQIQKHAVTRLTISKPHSPYYLPCIPILTPYNH 87
            |.||.:...|:   .|..|:.|  .|..:.|.|......:|.:|.:. |||..|.|..:..|   
Human  2332 HTGRYSCVAEN---LAGRAERKFELSVLVPPELIGDLDPLTNITAAL-HSPLTLLCEAMGIP--- 2389

  Fly    88 DQDNQPIYCSWYRNDVVVEQVSYRKNDFFIYDNGTLRL-PTNEKASGEYYCKIEWDESAVISDRI 151
                 |....|:|.:   |.||..::.:.:.....|:: .|.|:.||.|.| :..:|:.......
Human  2390 -----PPAIRWFRGE---EPVSPGEDTYLLAGGWMLKMTQTQEQDSGLYSC-LASNEAGEARRNF 2445

  Fly   152 TVEYPVLKRLFPGQQQAANISALENKPLVLSCPFLSVPAARFSWYFGNDSLTNDNSALILTNGTL 216
            :||..|...: ..:.....|..|:.:...|.|.....|..:.:|:.....|...::..|..:|.|
Human  2446 SVEVLVPPSI-ENEDLEEVIKVLDGQTAHLMCNVTGHPQPKLTWFKDGRPLARGDAHHISPDGVL 2509

  Fly   217 I-LRHLRLEQAGKYKCVAQNTFASKTHRQFIWQLQVEPKDATFYPKNEAGITETAVSEAQLLPAF 280
            : :....|..||.|.|:|.|....||..   :||.|     ...|....|..::|..|       
Human  2510 LQVLQANLSSAGHYSCIAANAVGEKTKH---FQLSV-----LLAPTILGGAEDSADEE------- 2559

  Fly   281 QNATVFVPAGGSVLLQCHAVADFVPIVWYLQP----PNNKMVRLSNNSVAYSITNASIARHEGRY 341
                |.|.....:.|.|.|:|...|.:.:::.    ..::.::|...:....|.||. ....|:|
Human  2560 ----VTVTVNNPISLICEALAFPSPNITWMKDGAPFEASRNIQLLPGTHGLQILNAQ-KEDAGQY 2619

  Fly   342 SCITPLE----TQNFQVIVTTPPRI-----VSRLPVEVVYIGLSRTLT--CRAEGHPEPSITWYH 395
            :|:...|    .:|:.|.|..||.|     ::.:.|:.|...::.|||  |.:...|.|:|.||.
Human  2620 TCVVTNELGEAVKNYHVEVLIPPSISKDDPLAEVGVKEVKTKVNSTLTLECESWAVPPPTIRWYK 2684

  Fly   396 NGVHLNSSYTRYI--SGNELHVHSFDSKEEGIYQCVARNVAGEDSATGELRFNRQLEEVNPL-QN 457
            :|..:..|....:  .|..|.:......:.|.|.|||.||||||    :..|| .|.:|.|: |.
Human  2685 DGQPVTPSSRLQVLGEGRLLQIQPTQVSDSGRYLCVATNVAGED----DQDFN-VLIQVPPMFQK 2744

  Fly   458 IRCYPHSFHSINITFDSRTLTSMFVVYIVRNNPH--------------SW-TSFSPMKLNQTSYV 507
            :..:..:|..::...::|...:.: ..||.|||.              :| ....|:.......|
Human  2745 VGDFSAAFEILSREEEARGGVTEY-REIVENNPAYLYCDTNAIPPPDLTWYREDQPLSAGDEVSV 2808

  Fly   508 V--------------------------ISTDLPVYEPFALITRVLFPTTEVRTGTLVPQQMILSS 546
            :                          :..|...||...|...|:...||    .||.:..:.:|
Human  2809 LQGGRVLQIPLVRAENAGRYSCKASNEVGEDWLHYELLVLTPPVILGDTE----ELVEEVTVNAS 2869

  Fly   547 LRSTPVTCCTQGLMLRPIAVGNDT-FVKWSQGQLENKKYFILQFSINHTHPHP-AQLLNGSLQGT 609
              ||....|.        |:||.. .:.|.|..        |.||     |.| .|:|... |..
Human  2870 --STVSLQCP--------ALGNPVPTISWLQNG--------LPFS-----PSPRLQVLEDG-QVL 2910

  Fly   610 LTSVEEKADQVRHH-LTEIQPLNQSAAATVLRNVEHEDNVVDDTLELEDDIFSLVVDA--SVTGI 671
            ..|..|.||...:. :.|    ||:.:|                    :.:|:|.|..  .:.|:
Human  2911 QVSTAEVADAASYMCVAE----NQAGSA--------------------EKLFTLRVQVPPRIAGL 2951

  Fly   672 LLQRFTRI----------------------KMRVLIITTENEFL--------------------- 693
            .|::.|.|                      |....:...|..||                     
Human  2952 DLEQVTAILNSSVSLPCDVHAHPNPEVTWYKDSQALSLGEEVFLLPGTHTLQLGRARLSDSGMYT 3016

  Fly   694 -------GQDFRYVQWKIIENGTSEQSNMP--FRLVTRESRALAFKFLDSLNETCVLECHTEIQA 749
                   |:|.:.||..::         :|  ||...|..:...   |..:.:..||.|.|:   
Human  3017 CEALNAAGRDQKLVQLSVL---------VPPAFRQAPRGPQDAV---LVRVGDKAVLSCETD--- 3066

  Fly   750 QMSLPSQDPKCQDRNIANSLLLVTGLKPDTRYNLHFYNCKTRIFYGDIDEKTEQDPPGTISNSKL 814
              :||  :|                               |..:|.|       ..|..::....
Human  3067 --ALP--EP-------------------------------TVTWYKD-------GQPLVLAQRTQ 3089

  Fly   815 IKQNGLKL-MWEPPINPNGRVHHYDIRWSLDNVTHEAIVKECTKCSYKFPNVSETAKIHVAVRVM 878
            ..:.|.:| :.|..::..|.   |..:  :.||..||:  .....:.:.|...|..|.....:|.
Human  3090 ALRGGQRLEIQEAQVSDKGL---YSCK--VSNVAGEAV--RTFTLTVQVPPTFENPKTETVSQVA 3147

  Fly   879 GD--------TGAGAPMYFDMINNNHTWLKEESESSHSEVYSGIAIGSLLSIA-----------C 924
            |.        :|..||..        ||||:......|.|:..::.|..|.::           |
Human  3148 GSPLVLTCDVSGVPAPTV--------TWLKDRMPVESSAVHGVVSRGGRLQLSRLQPAQAGTYTC 3204

  Fly   925 V-----------FLFGLFIIFQQRNFKARAQGPT---HLTTPTDINFGNLSSASGMPGDSAGGLS 975
            |           |:..:.:.     .:.|:.|..   |:....::...  ..|.|.|......|.
Human  3205 VAENTQAEARKDFVVAVLVA-----PRIRSSGVAREHHVLEGQEVRLD--CEADGQPPPDVAWLK 3262

  Fly   976 GGT-LQQDCHEMQTLIPRSRYHIE--LLPEHSLEYQTSTAAVAVVHLANG--------NGSVQVA 1029
            .|: |.||      :.|..|::::  .|....|....:.|...|.|...|        |..|...
Human  3263 DGSPLGQD------MGPHLRFYLDGGSLVLKGLRASDAGAYTCVAHNPAGEDARLHTVNVLVPPT 3321

  Fly  1030 RRSDQDGAA-----QGDL--------GIAGVH----------NLSQLPLCGVGGTSPERKTVQDA 1071
            .:...||:.     .|:|        |...:|          .|||..|....|.:.....||  
Human  3322 IKQGADGSGTLVSRPGELVTMVCPVRGSPPIHVSWLKDGLPLPLSQRTLLHGSGHTLRISKVQ-- 3384

  Fly  1072 MLQEAKAF--------------YIPYRHTPPNAVALSSSKQCAVPSGSELEVI-----VPPNSLP 1117
             |.:|..|              :......||....:.......|..||.:|:.     ||   ||
Human  3385 -LADAGIFTCVAASPAGVADRNFTLQVQVPPVLEPVEFQNDVVVVRGSLVELPCEARGVP---LP 3445

  Fly  1118 LVTTM--------------PGLGV--VGGGGSGGGGVGGSSRRSGSLSSSSASSSSNGSSKKQFH 1166
            ||:.|              |.|.:  ||.|.||              :.|..:.|..|.:::.|.
Human  3446 LVSWMKDGEPLLSQSLEQGPSLQLEAVGAGDSG--------------TYSCVAVSEAGEARRHFQ 3496

  Fly  1167 TNFVRHSNSNDGIYLLAEEEAAATLTPTSEREYAAVCLTNGFKLPADVAKSGGGTYNTTNNNNSS 1231
            ...:...:..|     :.:....:|||.:..|  .:|...|...|.......|.......||:.:
Human  3497 LTVMEPPHIED-----SGQPTELSLTPGAPME--LLCDAQGTPQPNITWHKDGQALTRLENNSRA 3554

  Fly  1232 T------NTSQKSA---TAKERQPRG 1248
            |      |...:.|   |.....|.|
Human  3555 TRVLRVENVQVRDAGLYTCLAESPAG 3580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plumNP_651482.3 Ig 179..245 CDD:409353 17/66 (26%)
Ig strand B 179..183 CDD:409353 1/3 (33%)
Ig strand C 192..196 CDD:409353 0/3 (0%)
Ig strand E 214..218 CDD:409353 2/4 (50%)
Ig strand F 228..233 CDD:409353 2/4 (50%)
Ig strand G 242..245 CDD:409353 0/2 (0%)
IG_like 284..356 CDD:214653 17/79 (22%)
Ig 360..443 CDD:472250 28/91 (31%)
Ig strand B 377..381 CDD:409353 3/5 (60%)
Ig strand C 390..394 CDD:409353 1/3 (33%)
Ig strand E 411..415 CDD:409353 1/3 (33%)
Ig strand F 425..430 CDD:409353 2/4 (50%)
Ig strand G 438..441 CDD:409353 0/2 (0%)
FN3 804..886 CDD:238020 16/90 (18%)
HMCN2NP_001278744.1 ChlD <3..207 CDD:440853
IG_like 434..513 CDD:214653
IG_like 524..604 CDD:214653
Ig strand B 534..538 CDD:409353
Ig strand C 547..551 CDD:409353
Ig strand E 570..574 CDD:409353
Ig strand F 584..589 CDD:409353
Ig strand G 597..600 CDD:409353
I-set 608..692 CDD:400151
Ig strand B 625..629 CDD:409353
Ig strand C 638..642 CDD:409353
Ig strand E 660..664 CDD:409353
Ig strand F 674..679 CDD:409353
Ig strand G 687..690 CDD:409353
IG_like 712..782 CDD:214653
Ig strand B 715..719 CDD:409353
Ig strand C 728..732 CDD:409353
Ig strand E 748..752 CDD:409353
Ig strand F 762..767 CDD:409353
IG_like 792..879 CDD:214653
Ig strand B 803..807 CDD:409353
Ig strand C 816..820 CDD:409353
Ig strand E 845..849 CDD:409353
Ig strand F 859..864 CDD:409353
Ig strand G 872..875 CDD:409353
I-set 885..972 CDD:400151
Ig strand B 902..906 CDD:409353
Ig strand C 916..920 CDD:409353
Ig strand F 952..957 CDD:409353
Ig strand G 965..968 CDD:409353
Ig_3 975..1050 CDD:464046
Ig 1080..1161 CDD:472250
Ig strand B 1091..1095 CDD:409353
Ig strand C 1104..1108 CDD:409353
Ig strand E 1127..1131 CDD:409353
Ig strand F 1141..1146 CDD:409353
Ig strand G 1154..1157 CDD:409353
Ig 1165..1246 CDD:472250
Ig strand B 1182..1186 CDD:409353
Ig strand C 1195..1199 CDD:409353
Ig strand E 1212..1216 CDD:409353
Ig strand F 1226..1231 CDD:409353
Ig strand G 1239..1242 CDD:409353
IG_like 1258..1340 CDD:214653
Ig strand B 1269..1273 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1271..1298
Ig strand C 1282..1286 CDD:409353
Ig strand E 1306..1310 CDD:409353
Ig strand F 1320..1325 CDD:409353
I-set 1354..1433 CDD:400151
Ig strand B 1363..1367 CDD:409353
Ig strand C 1376..1380 CDD:409353
Ig strand E 1399..1403 CDD:409353
Ig strand F 1413..1418 CDD:409353
Ig strand G 1426..1429 CDD:409353
IG_like 1446..1527 CDD:214653
Ig strand B 1456..1460 CDD:409353
Ig strand C 1469..1473 CDD:409353
Ig strand E 1492..1497 CDD:409353
Ig strand F 1507..1512 CDD:409353
I-set 1542..1620 CDD:400151
Ig strand B 1543..1554 CDD:409353
Ig strand C 1563..1567 CDD:409353
Ig strand E 1586..1590 CDD:409353
Ig strand F 1600..1605 CDD:409353
Ig 1632..1705 CDD:472250
Ig strand B 1644..1648 CDD:409353
Ig strand C 1657..1661 CDD:409353
Ig strand E 1680..1684 CDD:409353
Ig strand F 1694..1699 CDD:409353
I-set 1729..1807 CDD:400151
Ig strand B 1737..1741 CDD:409353
Ig strand C 1750..1754 CDD:409353
Ig strand E 1772..1777 CDD:409353
Ig strand F 1787..1792 CDD:409353
Ig strand G 1800..1803 CDD:409353
Ig 1820..1893 CDD:472250
Ig strand B 1829..1833 CDD:409353
Ig strand C 1842..1846 CDD:409353
Ig strand E 1857..1861 CDD:409353
Ig strand F 1871..1876 CDD:409353
Ig strand G 1884..1887 CDD:409353
I-set 1895..1975 CDD:400151
Ig strand B 1912..1916 CDD:409353
Ig strand C 1925..1929 CDD:409353
Ig strand E 1948..1952 CDD:409353
Ig strand F 1962..1967 CDD:409353
Ig strand G 1975..1978 CDD:409353
Ig_3 1985..2061 CDD:464046
Ig_3 2079..2154 CDD:464046
Ig 2171..2261 CDD:472250
Ig strand B 2189..2193 CDD:409353
Ig strand C 2202..2206 CDD:409353
Ig strand E 2227..2231 CDD:409353
Ig strand F 2241..2246 CDD:409353
Ig strand G 2254..2257 CDD:409353
I-set 2273..2355 CDD:400151 7/25 (28%)
Ig strand B 2285..2289 CDD:409353
Ig strand C 2298..2302 CDD:409353
Ig strand E 2320..2325 CDD:409353
Ig strand F 2335..2340 CDD:409353 1/4 (25%)
Ig 2367..2449 CDD:472250 23/94 (24%)
Ig strand B 2379..2383 CDD:409353 1/3 (33%)
Ig strand C 2392..2396 CDD:409353 0/3 (0%)
Ig strand E 2415..2419 CDD:409353 1/3 (33%)
Ig strand F 2429..2434 CDD:409353 2/5 (40%)
Ig strand G 2442..2445 CDD:409353 0/2 (0%)
I-set 2464..2542 CDD:400151 21/80 (26%)
Ig strand B 2472..2476 CDD:409353 1/3 (33%)
Ig strand C 2485..2489 CDD:409353 0/3 (0%)
Ig strand E 2508..2512 CDD:409353 1/3 (33%)
Ig strand F 2522..2527 CDD:409353 2/4 (50%)
Ig strand G 2535..2538 CDD:409353 1/5 (20%)
I-set 2560..2638 CDD:400151 17/78 (22%)
Ig strand B 2568..2572 CDD:409353 1/3 (33%)
Ig strand C 2581..2585 CDD:409353 0/3 (0%)
Ig strand E 2604..2608 CDD:409353 0/3 (0%)
Ig strand F 2618..2623 CDD:409353 2/4 (50%)
I-set 2656..2728 CDD:400151 23/71 (32%)
Ig strand B 2666..2670 CDD:409353 2/3 (67%)
Ig strand C 2679..2683 CDD:409353 1/3 (33%)
Ig strand E 2702..2706 CDD:409353 1/3 (33%)
Ig strand F 2716..2721 CDD:409353 2/4 (50%)
Ig 2770..2847 CDD:472250 11/76 (14%)
Ig strand B 2777..2781 CDD:409353 0/3 (0%)
Ig strand C 2790..2794 CDD:409353 0/3 (0%)
Ig strand E 2814..2817 CDD:409353 0/2 (0%)
Ig strand F 2827..2832 CDD:409353 0/4 (0%)
Ig strand G 2840..2843 CDD:409353 0/2 (0%)
I-set 2864..2942 CDD:400151 27/125 (22%)
Ig strand B 2872..2876 CDD:409353 0/3 (0%)
Ig strand C 2885..2889 CDD:409353 0/3 (0%)
Ig strand E 2907..2912 CDD:409353 1/5 (20%)
Ig strand F 2922..2927 CDD:409353 0/4 (0%)
IG_like 2954..3034 CDD:214653 10/79 (13%)
Ig strand B 2964..2968 CDD:409353 0/3 (0%)
Ig strand C 2977..2981 CDD:409353 0/3 (0%)
Ig strand E 3000..3004 CDD:409353 0/3 (0%)
Ig strand F 3014..3019 CDD:409353 0/4 (0%)
I-set 3038..3129 CDD:400151 24/145 (17%)
Ig strand B 3059..3063 CDD:409353 2/3 (67%)
Ig strand C 3072..3076 CDD:409353 1/3 (33%)
Ig strand E 3095..3099 CDD:409353 1/3 (33%)
Ig strand F 3109..3114 CDD:409353 1/9 (11%)
Ig_3 3132..3208 CDD:464046 18/83 (22%)
I-set 3238..3308 CDD:400151 16/77 (21%)
Ig strand B 3244..3248 CDD:409353 0/5 (0%)
Ig strand C 3257..3261 CDD:409353 0/3 (0%)
Ig strand E 3282..3286 CDD:409353 1/3 (33%)
Ig strand F 3296..3301 CDD:409353 1/4 (25%)
I-set 3335..3410 CDD:400151 14/77 (18%)
Ig strand B 3340..3344 CDD:409353 0/3 (0%)
Ig strand C 3353..3357 CDD:409353 1/3 (33%)
Ig strand E 3376..3380 CDD:409353 0/3 (0%)
Ig strand F 3390..3395 CDD:409353 1/4 (25%)
Ig 3424..3499 CDD:472250 22/91 (24%)
Ig strand B 3433..3437 CDD:409353 1/3 (33%)
Ig strand C 3446..3450 CDD:409353 2/3 (67%)
Ig strand E 3464..3469 CDD:409353 2/4 (50%)
Ig strand F 3479..3484 CDD:409353 1/4 (25%)
Ig strand G 3492..3495 CDD:409353 0/2 (0%)
Ig 3503..3590 CDD:472250 17/85 (20%)
Ig strand B 3522..3526 CDD:409353 1/5 (20%)
Ig strand C 3535..3539 CDD:409353 0/3 (0%)
Ig strand E 3556..3560 CDD:409353 0/3 (0%)
Ig strand F 3570..3575 CDD:409353 1/4 (25%)
Ig strand G 3583..3586 CDD:409353
Ig 3602..3683 CDD:472250
Ig strand C 3626..3630 CDD:409353
Ig strand E 3648..3653 CDD:409353
Ig strand F 3663..3668 CDD:409353
Ig 3689..3765 CDD:472250
Ig strand B 3704..3708 CDD:409353
Ig strand C 3717..3721 CDD:409353
Ig strand E 3740..3744 CDD:409353
Ig strand F 3754..3759 CDD:409353
Ig_3 3777..3854 CDD:464046
Ig 3873..3958 CDD:472250
Ig strand B 3888..3892 CDD:409353
Ig strand C 3901..3905 CDD:409353
Ig strand E 3924..3928 CDD:409353
Ig strand F 3938..3943 CDD:409353
Ig strand G 3951..3954 CDD:409353
Ig_3 3962..4035 CDD:464046
I-set 4052..4139 CDD:400151
Ig strand B 4069..4073 CDD:409353
Ig strand C 4082..4086 CDD:409353
Ig strand E 4105..4109 CDD:409353
Ig strand F 4119..4124 CDD:409353
Ig strand G 4132..4135 CDD:409353
I-set 4143..4228 CDD:400151
Ig strand B 4160..4164 CDD:409353
Ig strand C 4173..4177 CDD:409353
Ig strand E 4194..4198 CDD:409353
Ig strand F 4208..4213 CDD:409353
Ig strand G 4223..4226 CDD:409353
I-set 4246..4317 CDD:400151
Ig strand B 4250..4254 CDD:409353
Ig strand C 4263..4267 CDD:409353
Ig strand E 4285..4289 CDD:409353
Ig strand F 4299..4304 CDD:409353
Ig 4324..4409 CDD:472250
Ig strand B 4340..4344 CDD:409353
Ig strand C 4353..4357 CDD:409353
Ig strand E 4375..4379 CDD:409353
Ig strand F 4389..4394 CDD:409353
Ig strand G 4402..4405 CDD:409353
nidG2 4411..4625 CDD:469646
FXa_inhibition 4652..4687 CDD:464251
EGF_CA 4689..4732 CDD:214542
EGF_CA 4733..4766 CDD:214542
EGF_CA 4776..4805 CDD:429571
EGF_CA 4883..4922 CDD:214542
EGF_CA 4923..4963 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.