DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5455 and Serac1

DIOPT Version :9

Sequence 1:NP_651481.1 Gene:CG5455 / 43196 FlyBaseID:FBgn0039430 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001104487.1 Gene:Serac1 / 321007 MGIID:2447813 Length:654 Species:Mus musculus


Alignment Length:226 Identity:84/226 - (37%)
Similarity:127/226 - (56%) Gaps:11/226 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 NDPNYSKCWPGDWLPLDCPGVRVIALNYTTDQYLWRPLWKSKEPRSSLIQRSREMAELLIQHRVG 527
            ::..|:.|||..||..|||.:|:|::.|.|....||.  :....|.|:..||.|:...|....||
Mouse   426 DEDRYTTCWPKTWLAKDCPSLRIISVEYDTSLSDWRA--RCPMERKSIAFRSNELLSKLRAAGVG 488

  Fly   528 HGRPIIYVGHSKGGLFIKQLMVDAWESGRPAMTPLWRSARGCFFYSVPHRGSHLASIKAP---LL 589
             .||:|::.||.|||.:|:::::|  |.:|.:..|..:.||..||||||.||.||.....   ||
Mouse   489 -DRPMIWISHSMGGLLVKKMLLEA--SKKPELNALINNTRGIIFYSVPHHGSRLAEYSVNIRYLL 550

  Fly   590 SRSVELLEIEKNNKYLLDLHRRFAGLYHLGHLKIEVFSFVETALTLM-SVLYLRIVGVDSADPGI 653
            ..|:|:.|:.|::..|..|...|  |........:|.:||||..|.: |::.|.:|.|:|||.||
Mouse   551 FPSLEVKELSKDSPALKTLQDDF--LEFAKDKNFQVLNFVETQPTFIGSMIKLHVVPVESADLGI 613

  Fly   654 GDVCGIRLDHREICKPRGRDCILYKELVKMI 684
            ||:..:.::|..||||:.:|..||:..::.|
Mouse   614 GDLIPVDVNHLNICKPKTKDAFLYQRTLQFI 644



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48182
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.