DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and golga7ba

DIOPT Version :9

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001017566.1 Gene:golga7ba / 550228 ZFINID:ZDB-GENE-050417-14 Length:173 Species:Danio rerio


Alignment Length:123 Identity:64/123 - (52%)
Similarity:92/123 - (74%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKVFIQRDYSEGTSVKFHTRLPAELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGCIT 91
            :||||||||::||..||.|:.|:||:..|||.:||.|:..||.:|||||:....:|.|||:.|:|
Zfish    35 NKVFIQRDYTDGTVCKFQTKFPSELDSRIERTLFEDTVKTLNTYYAEAEKIGGQSYIEGCLACLT 99

  Fly    92 AYLIYMCSETHYEKTLRKISKFVASQNERIYNTKGLQLIDPTYRGLRVIEITIFDRPG 149
            .|||::|.||.|||.|:|||:::..|||::|..:||.:.||..||:|||||::::..|
Zfish   100 VYLIFLCIETRYEKVLKKISRYIQEQNEKVYAPRGLLITDPIERGMRVIEISVYEDRG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 29..141 CDD:287258 59/111 (53%)
golga7baNP_001017566.1 Erf4 37..149 CDD:287258 59/111 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587209
Domainoid 1 1.000 137 1.000 Domainoid score I4849
eggNOG 1 0.900 - - E1_KOG4069
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4315
OMA 1 1.010 - - QHG47986
OrthoDB 1 1.010 - - D1528169at2759
OrthoFinder 1 1.000 - - FOG0003061
OrthoInspector 1 1.000 - - otm24670
orthoMCL 1 0.900 - - OOG6_104178
Panther 1 1.100 - - O PTHR13254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2421
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.