DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and golga7

DIOPT Version :9

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001016450.1 Gene:golga7 / 549204 XenbaseID:XB-GENE-981929 Length:135 Species:Xenopus tropicalis


Alignment Length:122 Identity:68/122 - (55%)
Similarity:88/122 - (72%) Gaps:0/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VFSKVFIQRDYSEGTSVKFHTRLPAELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGC 89
            |..||||||||:.||..:|.|:.|:|||..|:|..||.|:..||..|||||:....:|.|||:.|
 Frog     7 VAGKVFIQRDYTNGTLCQFQTKFPSELENRIDRQQFEETVRTLNNMYAEAEKLGGPSYLEGCLAC 71

  Fly    90 ITAYLIYMCSETHYEKTLRKISKFVASQNERIYNTKGLQLIDPTYRGLRVIEITIFD 146
            .|||.|::|.||||||.|:||:|::..|||::|..:||.|.||..||||||||||::
 Frog    72 FTAYTIFLCMETHYEKVLKKIAKYIQEQNEKMYAPQGLLLTDPIERGLRVIEITIYE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 29..141 CDD:287258 61/111 (55%)
golga7NP_001016450.1 Erf4 11..123 CDD:370926 61/111 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528169at2759
OrthoFinder 1 1.000 - - FOG0003061
OrthoInspector 1 1.000 - - otm47644
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2421
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.