DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and GOLGA7

DIOPT Version :9

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001002296.1 Gene:GOLGA7 / 51125 HGNCID:24876 Length:137 Species:Homo sapiens


Alignment Length:125 Identity:72/125 - (57%)
Similarity:90/125 - (72%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VFSKVFIQRDYSEGTSVKFHTRLPAELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGC 89
            |..|||||||||.||..:|.|:.|||||..|:|..||.|:..||..|||||:....:|.|||:.|
Human     8 VSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLAC 72

  Fly    90 ITAYLIYMCSETHYEKTLRKISKFVASQNERIYNTKGLQLIDPTYRGLRVIEITIFDRPG 149
            :|||.|::|.||||||.|:|:||::..|||:||..:||.|.||..||||||||||::..|
Human    73 LTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 29..141 CDD:287258 64/111 (58%)
GOLGA7NP_001002296.1 Erf4 12..124 CDD:402047 64/111 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152717
Domainoid 1 1.000 140 1.000 Domainoid score I4764
eggNOG 1 0.900 - - E1_KOG4069
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4350
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47986
OrthoDB 1 1.010 - - D1528169at2759
OrthoFinder 1 1.000 - - FOG0003061
OrthoInspector 1 1.000 - - otm40468
orthoMCL 1 0.900 - - OOG6_104178
Panther 1 1.100 - - LDO PTHR13254
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3403
SonicParanoid 1 1.000 - - X2421
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.