DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and GOLGA7B

DIOPT Version :10

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001010917.1 Gene:GOLGA7B / 401647 HGNCID:31668 Length:167 Species:Homo sapiens


Alignment Length:120 Identity:67/120 - (55%)
Similarity:90/120 - (75%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKVFIQRDYSEGTSVKFHTRLPAELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGCIT 91
            :|||||||||:||..:|.|:.|.||:..|||.:||.|:..||.||||||:....:|.|||:.|.|
Human    19 TKVFIQRDYSDGTICQFQTKFPPELDSRIERQLFEETVKTLNGFYAEAEKIGGSSYLEGCLACAT 83

  Fly    92 AYLIYMCSETHYEKTLRKISKFVASQNERIYNTKGLQLIDPTYRGLRVIEITIFD 146
            ||.|::|.||||||.|:|||:::..|||:|:..:||.|.||..||:|||||:|::
Human    84 AYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLLLTDPVERGMRVIEISIYE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 28..141 CDD:463029 63/112 (56%)
GOLGA7BNP_001010917.1 Erf4 20..133 CDD:463029 63/112 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..167
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.