DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and erf4

DIOPT Version :10

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_593939.1 Gene:erf4 / 2543113 PomBaseID:SPAC3F10.07C Length:172 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:24/89 - (26%)
Similarity:39/89 - (43%) Gaps:3/89 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VFIQRDYS-EGTSV-KFHTRLPAELEGMIERHVFEATINRLNEFYAEAE-EGSCGTYCEGCIGCI 90
            |.|:|||| .|... :|.|..|..|...:....::..|:.|||...||. ..|.|...:|.:..:
pombe     3 VRIERDYSVSGDKYPQFPTDYPVPLRAYVNLEDWDVFIHTLNEKLREAFCPWSIGNLLDGILSVL 67

  Fly    91 TAYLIYMCSETHYEKTLRKISKFV 114
            |.|:......:.:.|.:..|..::
pombe    68 TIYISEFVFGSIHRKRIGAIDLYI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 28..141 CDD:463029 24/89 (27%)
erf4NP_593939.1 Erf4 3..113 CDD:463029 24/89 (27%)

Return to query results.
Submit another query.