DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and erf4

DIOPT Version :9

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_593939.1 Gene:erf4 / 2543113 PomBaseID:SPAC3F10.07c Length:172 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:24/89 - (26%)
Similarity:39/89 - (43%) Gaps:3/89 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VFIQRDYS-EGTSV-KFHTRLPAELEGMIERHVFEATINRLNEFYAEAE-EGSCGTYCEGCIGCI 90
            |.|:|||| .|... :|.|..|..|...:....::..|:.|||...||. ..|.|...:|.:..:
pombe     3 VRIERDYSVSGDKYPQFPTDYPVPLRAYVNLEDWDVFIHTLNEKLREAFCPWSIGNLLDGILSVL 67

  Fly    91 TAYLIYMCSETHYEKTLRKISKFV 114
            |.|:......:.:.|.:..|..::
pombe    68 TIYISEFVFGSIHRKRIGAIDLYI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 29..141 CDD:287258 24/89 (27%)
erf4NP_593939.1 Erf4 3..113 CDD:287258 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13254
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.