DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and Y57G11C.33

DIOPT Version :9

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001255818.1 Gene:Y57G11C.33 / 178394 WormBaseID:WBGene00013323 Length:177 Species:Caenorhabditis elegans


Alignment Length:167 Identity:57/167 - (34%)
Similarity:85/167 - (50%) Gaps:21/167 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQGGGTTPAGGNPTALQATGGG--------VVF--------SKVFIQRDYSEGTSVKFHTRLPA 49
            |:|..||.....|     .|.||        |:.        .::|||||||:|..|:|....||
 Worm     1 MAQKPGTMAQMRN-----GTSGGDKRQYETEVIILNQCRKLNGQIFIQRDYSKGLDVQFEAEYPA 60

  Fly    50 ELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGCITAYLIYMCSETHYEKTLRKISKFV 114
            .|...:.|.|:|.||.|:|..:|:||..:..|..|..:||.|.|..|..:::.|.:.|.::.:|:
 Worm    61 RLTEKVPRDVWENTIVRINRIFADAEAITPQTIFETVLGCFTCYASYAITKSTYRRKLDELQEFL 125

  Fly   115 ASQNERIYNTKGLQLIDPTYRGLRVIEITIFDRPGRT 151
            ..:|..||:..|..:.:|..|||||:||::..|.|.|
 Worm   126 NRENREIYHHVGFHIRNPMERGLRVLEISLLSRQGET 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 29..141 CDD:287258 43/111 (39%)
Y57G11C.33NP_001255818.1 Erf4 40..152 CDD:370926 43/111 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162592
Domainoid 1 1.000 87 1.000 Domainoid score I5119
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I3598
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47986
OrthoDB 1 1.010 - - D1528169at2759
OrthoFinder 1 1.000 - - FOG0003061
OrthoInspector 1 1.000 - - oto20515
orthoMCL 1 0.900 - - OOG6_104178
Panther 1 1.100 - - LDO PTHR13254
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3403
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.