DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5447 and golga7b

DIOPT Version :9

Sequence 1:NP_001262986.1 Gene:CG5447 / 43192 FlyBaseID:FBgn0039427 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_002936481.1 Gene:golga7b / 100493768 XenbaseID:XB-GENE-953998 Length:167 Species:Xenopus tropicalis


Alignment Length:120 Identity:65/120 - (54%)
Similarity:89/120 - (74%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKVFIQRDYSEGTSVKFHTRLPAELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGCIT 91
            :|||||||||:||..:|.|:.|.|||..||:.:||.|:..||.:|.|||:....:|.|||:.|:|
 Frog    19 TKVFIQRDYSDGTMCQFQTKFPTELESRIEKQLFEETVKTLNMYYIEAEKIGGSSYLEGCLACVT 83

  Fly    92 AYLIYMCSETHYEKTLRKISKFVASQNERIYNTKGLQLIDPTYRGLRVIEITIFD 146
            ||.|:.|.||||||.|:||||::..|||:||..:||.:.||..||:|||||::::
 Frog    84 AYFIFFCMETHYEKVLKKISKYIQEQNEKIYAPRGLLITDPVERGMRVIEISVYE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5447NP_001262986.1 Erf4 29..141 CDD:287258 61/111 (55%)
golga7bXP_002936481.1 Erf4 21..133 CDD:370926 61/111 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H28514
Inparanoid 1 1.050 149 1.000 Inparanoid score I4274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528169at2759
OrthoFinder 1 1.000 - - FOG0003061
OrthoInspector 1 1.000 - - otm47644
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2421
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.