DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hex-t2 and HK3

DIOPT Version :10

Sequence 1:NP_733151.2 Gene:Hex-t2 / 43191 FlyBaseID:FBgn0042710 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_002106.2 Gene:HK3 / 3101 HGNCID:4925 Length:923 Species:Homo sapiens


Alignment Length:117 Identity:22/117 - (18%)
Similarity:45/117 - (38%) Gaps:27/117 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MIRSVCLGKTKVAEELVN--------GLRE-----SKFADVKELKCYVNCVMEMMQTMKKGKLNY 85
            :::|||..:|..|.:.:|        ||..     |.:..:::...|.|..:.:....:|...||
Human   127 ILKSVCGYQTFFAGKYLNEYGAPDAGGLEHIPLGWSYWYALEKNSKYYNYTLSINGKARKHGENY 191

  Fly    86 DASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNP 137
            ...      .:.|.||......||        .|:|.:..::::...:.::|
Human   192 SVD------YLTDVLANLSLDFLD--------YKSNSEPFFMMISTPAPHSP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hex-t2NP_733151.2 ASKHA_NBD_HK_meta 51..477 CDD:466869 17/100 (17%)
HK3NP_002106.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
ASKHA_NBD_HK3_meta_rpt1 41..471 CDD:466940 22/117 (19%)
Hexokinase small subdomain 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01084 84..220 21/106 (20%)
Hexokinase large subdomain 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01084 221..460 1/9 (11%)
ASKHA_NBD_HK1-3_meta_rpt2 491..916 CDD:466941
Hexokinase small subdomain 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01084 531..661
Hexokinase large subdomain 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01084 662..901
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.