DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Olig3

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_443734.2 Gene:Olig3 / 94222 MGIID:2149955 Length:273 Species:Mus musculus


Alignment Length:266 Identity:73/266 - (27%)
Similarity:102/266 - (38%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNAPTKSKTKA 88
            ::||....:|.:|:   :.||.       .|||.:.|.        |:.|.:|.| ...|.:...
Mouse    34 QESRLNSVSSTQGD---MVQKM-------PGESLSRAG--------AKAAGESSK-YKIKKQLSE 79

  Fly    89 PPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITML 153
            ..|.:.|.| .|.|||.||.::|.|.:.||..:|.| .|...    .||:||.||.||..||.||
Mouse    80 QDLQQLRLK-INGRERKRMHDLNLAMDGLREVMPYA-HGPSV----RKLSKIATLLLARNYILML 138

  Fly   154 TDSIRDPSYESEFIGECL--EESANREARVDLEANEEAEVELPV-PVAKKPAKTKGSGKKSSAAS 215
            |.|:.:   ....:||..  ..||.....|...|...|.....| ||.........||..||..|
Mouse   139 TSSLEE---MKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHPVHPILGGALSSGNASSPLS 200

  Fly   216 KRQSQKQAKI--------VPQIPP---ISSGESCYA-----TSSIGSPASSAYASLSSSSNSHSS 264
            .........|        .|..||   :.||...:|     .:....|.....::||:::.:..|
Mouse   201 ATSLPTIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLS 265

  Fly   265 SSSPGL 270
            :.|..|
Mouse   266 AESKDL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 26/58 (45%)
Olig3NP_443734.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 14/56 (25%)
HLH 86..139 CDD:306515 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5457
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.