DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and mespa

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001039184.1 Gene:mespa / 734031 XenbaseID:XB-GENE-920825 Length:310 Species:Xenopus tropicalis


Alignment Length:231 Identity:54/231 - (23%)
Similarity:89/231 - (38%) Gaps:74/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SNEDGESANLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSK--YR--RKTANARERTRMREI 110
            :||...|.:.|..|:|          ..|:.|..:.||....::  |.  |.:|:.||:.|||.:
 Frog    57 ANEAYGSIHTAFTQME----------KLKSKPQDTSTKKDQRNRKVYDRVRNSASEREKMRMRNL 111

  Fly   111 NTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECLEESA 175
            ::|.:.||..:|.|:     |...:.||||.||||.::||:.|::.:   ..:.|.:.:..||..
 Frog   112 SSALQNLRRYLPPAV-----APIGKTLTKIETLRLTIRYISHLSEVL---GLDEETLIKRREEEM 168

  Fly   176 NR--------------------EARVD----------------------LEANEEAEVELPVPVA 198
            .|                    |||..                      |||.|:.        .
 Frog   169 RRSNMCHIGLCCCQDRQHNLCSEARPHSSETVNLPYFSSSPRLFPEQNILEAQEQE--------F 225

  Fly   199 KKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISS 234
            ::||:....||.|......:|.....:..:  |::|
 Frog   226 QQPARWATDGKASDLGDHMKSFSSCALASE--PVNS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 23/60 (38%)
mespaNP_001039184.1 bHLH_SF 97..160 CDD:381792 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.