DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and msgn1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:164 Identity:44/164 - (26%)
Similarity:71/164 - (43%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NDMARATDSKDSRKRKTAS----ARGEKYSLRQKRQKRG-----SNEDGESANLADFQLELDPIA 70
            :|.|.::||:.:.....::    ...|:|||.|....:.     |.|...|::.....||    .
 Frog    13 DDYALSSDSEPNSSCMASTWDWKNNDERYSLSQTPSPQSLSPAVSYESPYSSSSHTQGLE----E 73

  Fly    71 EPASKSRKNAPT-----------KSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEA 124
            .|.|.|....|:           |.....|.::..||:.|:.||:.|||.|..|..|||:.:|..
 Frog    74 MPFSYSLLQYPSLCHGDNGDLTKKDHGHKPSMTVQRRRKASEREKLRMRAIAEALHTLRNNLPPM 138

  Fly   125 IKGEDAANTNEKLTKITTLRLAMKYITMLTDSIR 158
            .     :...:.||||.||:..:.||:.||:.::
 Frog   139 Y-----SQGRQPLTKIQTLKCTINYISELTNLLQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 22/58 (38%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 12/55 (22%)
bHLH_TS_Msgn1 102..167 CDD:381509 25/69 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.