DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and TFAP4

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_003214.1 Gene:TFAP4 / 7023 HGNCID:11745 Length:338 Species:Homo sapiens


Alignment Length:259 Identity:59/259 - (22%)
Similarity:98/259 - (37%) Gaps:73/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKI 140
            |..|.|...:|:.....:.||:.||:.||.||:.||..|::|:..:|.        ...|||:|.
Human    30 SLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPH--------TDGEKLSKA 86

  Fly   141 TTLRLAMKYITML----TDSIRDPSYESEFIGECLEESANREARV----------DLEANEEAE- 190
            ..|:...:||..|    |..::..:....||.| |..|:.:..|.          |:..:|:|| 
Human    87 AILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQE-LSGSSPKRRRAEDKDEGIGSPDIWEDEKAED 150

  Fly   191 -----VELPVPVAKK-------------------PAKTKGSGKKSSAASKRQSQKQAKIVPQ--- 228
                 :||...:.|:                   |.|.|...::   ...:|.|:|.:::.|   
Human   151 LRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQ---VQLQQQQEQVRLLHQEKL 212

  Fly   229 -----------IPPISSGESCYATSSIGSPASSAYASL-----SSSSNSHSSSSSPGLELDSLV 276
                       :||.:.............|..|.:.::     ||..||.|:|..   .||::|
Human   213 EREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQ---NLDTIV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 21/62 (34%)
TFAP4NP_003214.1 HLH 49..100 CDD:306515 20/58 (34%)
Leucine-zipper 1 100..120 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..141 4/23 (17%)
Leucine-zipper 2 151..179 3/27 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.