DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and TCF3

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_024307437.1 Gene:TCF3 / 6929 HGNCID:11633 Length:710 Species:Homo sapiens


Alignment Length:212 Identity:58/212 - (27%)
Similarity:84/212 - (39%) Gaps:58/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSNTYELHNYA-------DLNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESAN 58
            :..:|..:||:|       .|.|::|..||.....|..|:|...:.       ||...||.|:.:
Human   508 LAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEI-------KREEKEDEENTS 565

  Fly    59 LADFQLELDPIAEPASKSRKNAPTKSKTK--------APP-----LSKYRRKTANARERTRMREI 110
            .||...|        .|....|| :::|.        .||     ..|.||...|||||.|:|:|
Human   566 AADHSEE--------EKKELKAP-RARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDI 621

  Fly   111 NTAFETL-RHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECLEES 174
            |.||:.| |.|       :...|:.:..||:..|..|:..|..|...:|             |.:
Human   622 NEAFKELGRMC-------QLHLNSEKPQTKLLILHQAVSVILNLEQQVR-------------ERN 666

  Fly   175 ANREARVDLEANEEAEV 191
            .|.:|.. |:..||.:|
Human   667 LNPKAAC-LKRREEEKV 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 22/59 (37%)
TCF3XP_024307437.1 Paf1 <552..606 CDD:309201 15/69 (22%)
HLH 611..664 CDD:197674 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6641
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.