DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Msgn1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001103021.1 Gene:Msgn1 / 689864 RGDID:1587516 Length:187 Species:Rattus norvegicus


Alignment Length:125 Identity:41/125 - (32%)
Similarity:60/125 - (48%) Gaps:25/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DGESANLADFQLELD-------PI---AEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRM 107
            ||.|::.|...:|||       |.   |....|.:|.:..|       :|..||:.|:.||:.||
  Rat    74 DGYSSHEAGGLVELDYSMLAFQPSYIHAAGGLKGQKGSKVK-------MSVQRRRKASEREKLRM 131

  Fly   108 REINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSI---RDPSYES 164
            |.:..|..|||:.:|...     :...:.||||.||:..:|||..|||.:   |:|..:|
  Rat   132 RTLADALHTLRNYLPPVY-----SQRGQPLTKIQTLKYTIKYIRELTDLLNGGREPRPQS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 22/58 (38%)
Msgn1NP_001103021.1 HLH 119..173 CDD:278439 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.