DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and NEUROG2

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_076924.1 Gene:NEUROG2 / 63973 HGNCID:13805 Length:272 Species:Homo sapiens


Alignment Length:303 Identity:83/303 - (27%)
Similarity:112/303 - (36%) Gaps:86/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSNTYELHNYAD-----------LNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDG 54
            :||.|.||....|           |..:...:.|.|..:.:...|.|.  :.||:..:.|....|
Human     3 VKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGG--ARRQRGAEAGQGARG 65

  Fly    55 ESANLAD-------FQLELDPIAEPA-----SKSRKNAPTKSKTKAPPLSKYRRKTANARERTRM 107
            ..|..|:       ..|..|....|:     |:..|.|.|..:.|     |.||..||.|||.||
Human    66 GVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIK-----KTRRLKANNRERNRM 125

  Fly   108 REINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECLE 172
            ..:|.|.:.||..:|..  .|||     |||||.|||.|..||..||:::|       ....|..
Human   126 HNLNAALDALREVLPTF--PEDA-----KLTKIETLRFAHNYIWALTETLR-------LADHCGG 176

  Fly   173 ESANREARVDLEANEEAEVELPVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGES 237
            ........:..||           |...|      |..|:|.|                 |||:|
Human   177 GGGGLPGALFSEA-----------VLLSP------GGASAALS-----------------SSGDS 207

  Fly   238 ---CYATSSIGSPASSAYASLSSSSNSHSSSSSP----GLELD 273
               ....|...|||.|:..| |:|::.:|.:.||    |.::|
Human   208 PSPASTWSCTNSPAPSSSVS-SNSTSPYSCTLSPASPAGSDMD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 28/58 (48%)
NEUROG2NP_076924.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..69 8/40 (20%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 34/86 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..264 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.