DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Olig1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_068538.2 Gene:Olig1 / 60394 RGDID:621129 Length:261 Species:Rattus norvegicus


Alignment Length:96 Identity:32/96 - (33%)
Similarity:51/96 - (53%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PIAEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAAN 132
            |:|||...:.::...::..|.....:..|:..|:|||.||:::|.|.:.||    |.|....||:
  Rat    69 PLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALR----EVILPYSAAH 129

  Fly   133 ----TNEKLTKITTLRLAMKYITMLTDSIRD 159
                ...||:||.||.||..||.:|..|:::
  Rat   130 CQGAPGRKLSKIATLLLARNYILLLGSSLQE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 25/62 (40%)
Olig1NP_068538.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..105 8/35 (23%)
bHLH_TS_OLIG1 96..165 CDD:381512 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.