DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Neurog3

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_067732.1 Gene:Neurog3 / 60329 RGDID:631350 Length:214 Species:Rattus norvegicus


Alignment Length:280 Identity:75/280 - (26%)
Similarity:97/280 - (34%) Gaps:117/280 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNAPTKSKTKA 88
            :|..:.:....||....||.:|..|         |....:|.|       ||.|::         
  Rat    44 RDCSEAEAGDCRGTSRKLRARRGGR---------NRPKSELAL-------SKQRRS--------- 83

  Fly    89 PPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITML 153
                  |||.||.|||.||..:|:|.:.||..:|..  .:||     |||||.|||.|..||..|
  Rat    84 ------RRKKANDRERNRMHNLNSALDALRGVLPTF--PDDA-----KLTKIETLRFAHNYIWAL 135

  Fly   154 TDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKKPAKTKGSGKKSSAASKRQ 218
            |.::|...:  .|.|.                      |.|||..:  ..:.|.|          
  Rat   136 TQTLRIADH--SFYGP----------------------EPPVPCGE--LGSPGGG---------- 164

  Fly   219 SQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSSSNSHSSSSSPGLELDSLVGLNGISA 283
                          |||:    ..||.||.|.| .|||.::   |....|||::.|         
  Rat   165 --------------SSGD----WGSIYSPVSQA-GSLSPTA---SLEEFPGLQVPS--------- 198

  Fly   284 LDSLLLDTSDGDSLSCLSPG 303
                        |.|||.||
  Rat   199 ------------SPSCLLPG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 28/58 (48%)
Neurog3NP_067732.1 bHLH_TS_NGN3_ATOH5 77..144 CDD:381561 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.