DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and mespaa

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_571626.1 Gene:mespaa / 58069 ZFINID:ZDB-GENE-000406-8 Length:223 Species:Danio rerio


Alignment Length:228 Identity:61/228 - (26%)
Similarity:92/228 - (40%) Gaps:59/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQ---LELDPIAEPASKSRKNAPTKSKT 86
            ||:.:..|.:....||      ..||.....|.:...|.   ..|.|...|.|..:.:.....:|
Zfish    19 DSQNQSFAVSDAGYYS------ATGSLSPTSSIDSCSFSPPAYSLLPQIFPKSIQKTDVQPPKRT 77

  Fly    87 KAPPLSKY---RRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMK 148
             ..|.||:   :|:||:.||:.|||::..|...||..:|.::     |...:.||||.|||||::
Zfish    78 -GRPKSKFPGVKRQTASEREKLRMRDLTKALHHLRTFLPASV-----APVGKTLTKIETLRLAIQ 136

  Fly   149 YITMLTDSIRDPSYESEFIGECLEESANREARVDL-EANEEAEVELPVPVAKKPAKTKGS--GKK 210
            ||:.|:|.:           .|.|:       |:: ||.:|.            ..|..|  ...
Zfish   137 YISCLSDQL-----------GCGED-------VEICEAQDEV------------ISTSASVFDNF 171

  Fly   211 SSAASKRQSQKQAKIVPQIPPISSGESCYATSS 243
            |||:|..||....:.:..        |||.|.:
Zfish   172 SSASSASQSLPAQQFMSM--------SCYQTQN 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 24/58 (41%)
mespaaNP_571626.1 HLH 88..141 CDD:278439 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.