DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and bhlhe23

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001025304.1 Gene:bhlhe23 / 559796 ZFINID:ZDB-GENE-050913-22 Length:227 Species:Danio rerio


Alignment Length:254 Identity:59/254 - (23%)
Similarity:89/254 - (35%) Gaps:90/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATDSKDSRKRKTASARGEKYSLRQ------KRQKRGSNEDGESANLADFQLELDPIAEPASKSRK 78
            |.|....:..|:..:.||:.|...      :.:|||:..|.|.              .|.|.::|
Zfish    48 AADFLSGQTGKSNESGGEQTSDEDDGFDNLESRKRGAGFDEEK--------------HPGSLTKK 98

  Fly    79 NAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTL 143
            :...:|          .|.:.|||||.||.::|.|.:.||..:|.|     .:.:..||:||.||
Zfish    99 SKEQRS----------LRLSINARERRRMHDLNDALDGLRSVIPYA-----HSPSVRKLSKIATL 148

  Fly   144 RLAMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKKPAKTKGSG 208
            .||..||.|.              .:.|||.    .|:....|:...:..|:|.|..|.      
Zfish   149 LLAKNYILMQ--------------AQALEEM----RRLVAYLNQGQTITSPIPTALAPF------ 189

  Fly   209 KKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSSSNSHSSSSS 267
                        .||.:.|.                   :|:|.|:.:...||.|.:.|
Zfish   190 ------------GQAAVYPF-------------------SSTALATCAEKCNSFSGTPS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 25/58 (43%)
bhlhe23NP_001025304.1 HLH 110..164 CDD:197674 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.