DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and MESP1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_061140.1 Gene:MESP1 / 55897 HGNCID:29658 Length:268 Species:Homo sapiens


Alignment Length:234 Identity:64/234 - (27%)
Similarity:91/234 - (38%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SNEDGESANLADFQLELDPIAEPASKSR---KNAPTKSK--TKAPPLSKYRRKTANARERTRMRE 109
            |:.|...:..||     .|:|.||....   ..||:..:  .::..|...:|::|:.||:.|||.
Human    38 SSPDSWGSTPAD-----SPVASPARPGTLRDPRAPSVGRRGARSSRLGSGQRQSASEREKLRMRT 97

  Fly   110 INTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECLEES 174
            :..|...||..:|.::     |...:.||||.|||||::||..|          |..:| ..|||
Human    98 LARALHELRRFLPPSV-----APAGQSLTKIETLRLAIRYIGHL----------SAVLG-LSEES 146

  Fly   175 ANREARVDLEANEEAEVEL---PVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGE 236
            ..|..|...:|.......|   ..| |:...:|:..|:.........|..:|......||...|.
Human   147 LQRRCRQRGDAGSPRGCPLCPDDCP-AQMQTRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGA 210

  Fly   237 SCYATSSIGSPASSAYASLSSSSNSHSSSSSPGLELDSL 275
            .. |......||..|.|:.........|..||.|..|.|
Human   211 RA-APEPRDPPALFAEAACPEGQAMEPSPPSPLLPGDVL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 23/58 (40%)
MESP1NP_061140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..93 15/59 (25%)
bHLH_TS_Mesp 83..147 CDD:381508 28/79 (35%)
CPLCP 163..167 1/3 (33%)
2 X 2 AA tandem repeats of G-Q 182..185 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.