DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and ASCL1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens


Alignment Length:205 Identity:45/205 - (21%)
Similarity:82/205 - (40%) Gaps:61/205 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIA--EPASKSRKNAP---TKSKTKAPPL 91
            |:|.....|.:|::|::...:...         :|.|.|  :|:....|:||   .:.::.:|.|
Human    41 AAAAAAAQSAQQQQQQQQQQQQAP---------QLRPAADGQPSGGGHKSAPKQVKRQRSSSPEL 96

  Fly    92 SKYRRK-------------------TANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKL 137
            .:.:|:                   ..|.|||.|::.:|..|.|||..||...       .|:|:
Human    97 MRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGA-------ANKKM 154

  Fly   138 TKITTLRLAMKYITMLTDSIRD------------------PSYESE---FIGECLEESANREARV 181
            :|:.|||.|::||..|...:.:                  |:|.::   ..|..:...::.|...
Human   155 SKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSY 219

  Fly   182 DLEANEEAEV 191
            |..:.||.|:
Human   220 DPLSPEEQEL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 22/77 (29%)
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 13/64 (20%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.