DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and cato

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster


Alignment Length:117 Identity:44/117 - (37%)
Similarity:59/117 - (50%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QLELDPIAE-------PASKSRKNAPTKSKTK---------APPLSKYRRKTANARERTRMREIN 111
            |.||.||.|       |.:|.|.|:.|.|..:         :|.:.|.||:.||||||.||..:|
  Fly    56 QTELGPIMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLN 120

  Fly   112 TAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYE 163
            .|||.||..||       |.:.::||:|..||::|..||..|.|.:.:...|
  Fly   121 AAFERLREVVP-------APSIDQKLSKFETLQMAQSYILALCDLLNNGDVE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 27/58 (47%)
catoNP_477344.1 HLH 104..155 CDD:278439 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.