DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and dimm

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:393 Identity:80/393 - (20%)
Similarity:125/393 - (31%) Gaps:126/393 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSNTYELHNYADLNDMARATD-------SKDSRKRKTASARGEKYSL-RQKRQKRGSNEDGESA 57
            :.:|||:|    ::.|.:..:|       |.:.....|.:......|| .|....||..:...|.
  Fly    59 LSNNTYDL----EMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSG 119

  Fly    58 NLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSK---YRRKTANARERTRMREINTAFETLRH 119
            ....   .:.|.:..::.|..|.....:.|....:|   .||..:|.|||.||..:|.||::||.
  Fly   120 ACPS---TIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLRE 181

  Fly   120 CVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLE 184
            .:|.       .....:|:||.||.||..||..||..|.               |...|....||
  Fly   182 VIPH-------VEMERRLSKIETLTLAKNYIINLTHIIL---------------SKRNEEAAALE 224

  Fly   185 ANEEAEVELPVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPAS 249
            .|..|               .|....|:.:|:...           |::|          |.||:
  Fly   225 LNSGA---------------VGGVLLSNLSSESGG-----------PVAS----------GIPAN 253

  Fly   250 SAYASLSSSSNSHSSSSSPGLELDSLVGLNGISALDSLLLDTSDGDSLSCLSPGYGSLLTGSGES 314
            |..|::.......|.                 .|.|..:|..:|           ||||..:..:
  Fly   254 SNAATICFEDTLASG-----------------GAFDCAILAATD-----------GSLLNAATVT 290

  Fly   315 LLPGCRGDLPMSGLEKSDVELSLRLLDQSSKDSF----------------DFASDQQPSACISSF 363
            ..|.      |..::...:.|...:..|..:.|.                ...|.||||..::..
  Fly   291 TSPA------MQSIQSQAIHLQTPMEQQQQQASHLPHHQQAMHGHGHLGASIQSQQQPSLVLNGT 349

  Fly   364 SAL 366
            :::
  Fly   350 TSV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 23/58 (40%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.