DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and MSGN1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens


Alignment Length:110 Identity:35/110 - (31%)
Similarity:50/110 - (45%) Gaps:16/110 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVP 122
            |:..||        |........|...|.....:|..||:.|:.||:.|||.:..|..|||:.:|
Human    96 NMLAFQ--------PTHLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLP 152

  Fly   123 EAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSI---RDPSYES 164
            ...     :...:.||||.||:..:|||..|||.:   |:|..:|
Human   153 PVY-----SQRGQPLTKIQTLKYTIKYIGELTDLLNRGREPRAQS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 22/58 (38%)
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59
HLH 125..179 CDD:278439 22/58 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.