DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and AgaP_AGAP007241

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_564981.2 Gene:AgaP_AGAP007241 / 3290329 VectorBaseID:AGAP007241 Length:226 Species:Anopheles gambiae


Alignment Length:130 Identity:43/130 - (33%)
Similarity:62/130 - (47%) Gaps:21/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KTKAPP-----LSKYRRKTANARERTRMREINTAFETLRHCVP-------EAIKGEDAANTN--- 134
            :.:.||     ||..:||.||.|||.||..:|.|.:.||.|||       ..::.:||....   
Mosquito    18 RRRKPPSGSGVLSLVKRKKANQRERNRMHGLNDALDRLRMCVPLPASLTTATVRPDDAREATPTP 82

  Fly   135 -EKLTKITTLRLAMKYITMLTD---SIRDPSYES--EFIGECLEESANREARVDLEANEEAEVEL 193
             :||:||.|||||..||.:|.:   |.|...|:.  ..:|..|.::.....|..|..:|:.:..|
Mosquito    83 PQKLSKIDTLRLAQNYIAVLLEVLHSGRGMKYDRLLATLGRRLSQNTTNLLRTRLTLDEQLQAGL 147

  Fly   194  193
            Mosquito   148  147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 29/69 (42%)
AgaP_AGAP007241XP_564981.2 HLH 33..102 CDD:278439 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005380
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.