DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Mesp1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001101001.1 Gene:Mesp1 / 308766 RGDID:1311751 Length:242 Species:Rattus norvegicus


Alignment Length:223 Identity:59/223 - (26%)
Similarity:83/223 - (37%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PIAEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAAN 132
            |.|.||  .|...|.:..|....|...:|::|:.||:.|||.:..|...||..:|.::     |.
  Rat    52 PCARPA--RRAGTPGRRGTHGSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSV-----AP 109

  Fly   133 TNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPV 197
            ..:.||||.|||||::||..|          |..:|  |.|.:.|:.|       .|......|:
  Rat   110 IGQNLTKIETLRLAIRYIGHL----------SAVLG--LSEDSLRQQR-------HAVSPRGCPL 155

  Fly   198 AKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPA-------------S 249
            .           ..|..::.||     :.|.:.|:    :|...|...|||             |
  Rat   156 C-----------PDSGLAQAQS-----LGPHLSPV----ACSGVSWGSSPAYPRPRVAAESWDPS 200

  Fly   250 SAYASLSS--SSNSHSSSSSPGLELDSL 275
            ..|...:|  ......|.|||....|.|
  Rat   201 FLYTETASLERQEMEPSPSSPLFSSDML 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 23/58 (40%)
Mesp1NP_001101001.1 HLH 77..130 CDD:278439 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.