DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and atoh1a

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio


Alignment Length:278 Identity:71/278 - (25%)
Similarity:107/278 - (38%) Gaps:86/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPI----------AEPASKSRKNAPTKSK 85
            |.:|..| |.|...    ||:.:|.|:.....:....|:          |..|.:.|:.||:...
Zfish    52 TCAAHAE-YLLHSP----GSSAEGVSSASNFRKSSKSPVKVRELCRLKGAVGADEGRQRAPSSKS 111

  Fly    86 TKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYI 150
            |..  :.|.||..||||||.||..:|.||:.||..:|       |.:.::||:|..||::|..||
Zfish   112 TNV--VQKQRRMAANARERRRMHGLNHAFDELRSVIP-------AFDNDKKLSKYETLQMAQIYI 167

  Fly   151 TMLTDSIRDPSYESE------FIGECLEESANREAR------------------VDLEANEEAEV 191
            ..|:|.::.|..:::      .....||  .:|..|                  .|...|...|.
Zfish   168 NALSDLLQGPGAKADPPNCDLLHANVLE--TDRSPRGSPGVCRRGTGVGYPYQYEDGTFNSFMEQ 230

  Fly   192 ELPVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLS 256
            :|     :.|:.|..||.::|..|.|.::            |.||            .|.::..|
Zfish   231 DL-----QSPSGTSKSGSEASKDSPRSNR------------SDGE------------FSPHSHFS 266

  Fly   257 SSSNSHSSSSSPGLELDS 274
            .|..:|       |||.|
Zfish   267 DSDETH-------LELQS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 25/58 (43%)
atoh1aNP_571166.2 HLH 117..175 CDD:238036 28/64 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.