DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and neurog1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_571116.1 Gene:neurog1 / 30239 ZFINID:ZDB-GENE-990415-174 Length:208 Species:Danio rerio


Alignment Length:258 Identity:67/258 - (25%)
Similarity:92/258 - (35%) Gaps:105/258 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TDSKDSRK----RKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPA---SKSRK 78
            ||.:|||.    ...||:.|:                              |.|.||   .|.|:
Zfish    20 TDDEDSRSSLHPASPASSCGK------------------------------PPASPAGLQQKKRR 54

  Fly    79 NAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTL 143
            ....:::|....:.|.||..||.|||.||..:|.|.:.||..:|       |...:.|||||.||
Zfish    55 RGRARNETTVHVVKKNRRLKANDRERNRMHNLNDALDALRSVLP-------AFPDDTKLTKIETL 112

  Fly   144 RLAMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKKPAKTKGSG 208
            |.|..||..|:::||                                      :|.         
Zfish   113 RFAHNYIWALSETIR--------------------------------------IAD--------- 130

  Fly   209 KKSSAASKRQSQKQAKIVPQIPPISSGESCYATS-SIGSPASSAYASLSSSSNSHS-SSSSPG 269
                     |.|.:::..|.:.|   |.||.|.: |.||.:.|..:..||||:|.| .:|.||
Zfish   131 ---------QKQGKSRDGPLLLP---GLSCMADAPSPGSDSCSWPSGASSSSSSPSYCNSDPG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 26/58 (45%)
neurog1NP_571116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 14/71 (20%)
CCDC106 <20..>102 CDD:292422 31/118 (26%)
HLH 68..127 CDD:238036 28/65 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..180 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.